Recombinant Mouse DNAX Accessory Molecule-1/DNAM-1/CD226
| Product name: | Recombinant Mouse DNAX Accessory Molecule-1/DNAM-1/CD226 |
| Source: | Human Cells |
| Purity: | Greater than 95% as determined by reducing SDS-PAGE. |
| Buffer Formulation: | Lyophilized from a 0.2 μm filtered solution of PBS, pH7.4. |
| Applications: | Applications:SDS-PAGE; WB; ELISA; IP. |
| Storage: | Avoid repeated freeze/thaw cycles. Store at 2-8 oC for one month. Aliquot and store at -80 oC for 12 months. |
| UOM: | 100ug/50ug/200ug/1mg/1g |
| Source | Human Cells |
| Description | Recombinant Mouse DNAX Accessory Molecule-1 is produced by our Mammalian expression system and the target gene encoding Glu19-Pro254 is expressed fused with a 6His tag at the C-terminus. |
| Names | CD226 antigen; platelet and T cell activation antigen 1; CD226 molecule; DNAM1 adhesion glycoprotein; DNAM-1;DNAX accessory molecule-1; DNAX accessory molecule 1; PTA1; T lineage-specific activation antigen 1 antigen; CD226; PTA1; TLiSA1; |
| Accession # | Q8K4F0 |
| Formulation | Lyophilized from a 0.2 μm filtered solution of PBS, pH7.4. |
| Shipping |
The product is shipped at ambient temperature. |
| Reconstitution |
Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 μg/ml. Dissolve the lyophilized protein in ddH2O. Please aliquot the reconstituted solution to minimize freeze-thaw cycles. |
| Storage |
Lyophilized protein should be stored at < -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at < -20°C for 3 months. |
| Purity |
Greater than 95% as determined by reducing SDS-PAGE. |
| Endotoxin | Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test. |
| Amino Acid Sequence |
EETLWDTTVRLSETMTLECVYPLTHNLTQVEWTKNTGTKTVSIAVYNPNHNMHIESNYLHRVHFL NSTVGFRNMSLSFYNASEADIGIYSCLFHAFPNGPWEKKIKVVWSDSFEIAAPSDSYLSAEPGQD VTLTCQLPRTWPVQQVIWEKVQPHQVDILASCNLSQETRYTSKYLRQTRSNCSQGSMKSILIIPN AMAADSGLYRCRSEAITGKNKSFVIRLIITDGGTNKHFILPHHHHHH
|
| Background | Mouse DNAX accessory molecule-1(DNAM-1) is a type I transmembrane glycoprotein that belongs to the immunoglobulin superfamily. As an activating receptor, it interacts with the ligands CD155 and CD112, and activates natural killer (NK) cells via its immu-noreceptor tyrosine-based activatory motif (ITAM). Mature mouse DNAM-1 has extracellular domain (ECD) that contains two Ig-like C2-set domains, and possesses a cytoplasmic region that contains motifs for binding PDZ domains. DNAM-1 is expressed on several lymphoid and myeloid cell types and interacts with CD155/PVR and Nectin-2/CD112. Ligation of DNAM-1 promotes the activation of NK cells, CD8+ T cells, and mast cells, induces dendritic cell maturation, initiates megakaryocyte and activated platelet adhesion to vascular endothelial cells, and stimulates monocyte extravasation; Conversely, it inhibits the formation of osteoclasts. Platelet-endothelium interactions that are mediated by DNAM-1 enable the metastasis of tumor cells to the lung. |












