Recombinant Mouse Complement Factor D/Adipsin

Instruction Manual!

Product name:	Recombinant Mouse Complement Factor D/Adipsin
Source:	Human Cells
Purity:	Greater than 95% as determined by reducing SDS-PAGE.
Buffer Formulation:	Lyophilized from a 0.2 μm filtered solution of 20mMTris,150mMNaCl,pH7.5.
Applications:	Applications:SDS-PAGE; WB; ELISA; IP.
Storage:	Avoid repeated freeze/thaw cycles. Store at 2-8 oC for one month. Aliquot and store at -80 oC for 12 months.
UOM:	100ug/50ug/200ug/1mg/1g

Source	Human Cells
Description	Recombinant Mouse Complement factor D is produced by our Mammalian expression system and the target gene encoding Ile26-Ser259 is expressed with a 10His tag at the C-terminus.
Names	Complement factor D, 28 kDa adipocyte protein, Adipsin, C3 convertase activator, Properdin factor D, Cfd, Adn, Df
Accession #	P03953
Formulation	Lyophilized from a 0.2 μm filtered solution of 20mMTris,150mMNaCl,pH7.5.
Shipping	The product is shipped at ambient temperature.
Reconstitution	Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 μg/ml. Dissolve the lyophilized protein in ddH2O. Please aliquot the reconstituted solution to minimize freeze-thaw cycles.
Storage	Lyophilized protein should be stored at < -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at < -20°C for 3 months.
Purity	Greater than 95% as determined by reducing SDS-PAGE.
Endotoxin	Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
Amino Acid Sequence	ILGGQEAAAHARPYMASVQVNGTHVCGGTLLDEQWVLSAAHCMDGVTDDDSVQVLLGAHSLSAPE PYKRWYDVQSVVPHPGSRPDSLEDDLILFKLSQNASLGPHVRPLPLQYEDKEVEPGTLCDVAGWG VVTHAGRRPDVLHQLRVSIMNRTTCNLRTYHDGVVTINMMCAESNRRDTCRGDSGSPLVCGDAVE GVVTWGSRVCGNGKKPGVYTRVSSYRMWIENITNGNMTSHHHHHHHHHH
Background	Complement factor D, also known as adipsin, is a member of the chymotrypsin family of serine proteases, which plays an essential role in host defense as the rate-limiting enzyme in the alternative pathway of complement activation. Complement factor D activates a convertase (C3bBb) responsible for cleavage of the complement protein C3, which leads to the activation of terminal complement component C5-9 to form the membrane attack complex on microbial or cellular surfaces. It also functions in the regulation of systemic energy balance and physiologic and pathologic processes, including immunity and inflammation.