Recombinant Mouse Kallikrein 7/KLK7
Product name: | Recombinant Mouse Kallikrein 7/KLK7 |
Source: | Human Cells |
Purity: | Greater than 95% as determined by reducing SDS-PAGE. |
Buffer Formulation: | Lyophilized from a 0.2 μm filtered solution of 20mM HEPES,150mM NaCl,pH7.4. |
Applications: | Applications:SDS-PAGE; WB; ELISA; IP. |
Storage: | Avoid repeated freeze/thaw cycles. Store at 2-8 oC for one month. Aliquot and store at -80 oC for 12 months. |
UOM: | 100ug/50ug/200ug/1mg/1g |
Source | Human Cells |
Description | Recombinant Mouse Kallikrein 7 is produced by our Mammalian expression system and the target gene encoding Gln22-Arg249 is expressed with a 6His tag at the C-terminus. |
Names | Kallikrein-7, Klk7, Serine protease 6, Stratum corneum chymotryptic enzyme, Thymopsin, kallikrein-related peptidase 7, PRSS6, SCCEkallikrein-7 |
Accession # | Q91VE3 |
Formulation | Lyophilized from a 0.2 μm filtered solution of 20mM HEPES,150mM NaCl,pH7.4. |
Shipping |
The product is shipped at ambient temperature. |
Reconstitution |
Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 μg/ml. Dissolve the lyophilized protein in ddH2O. Please aliquot the reconstituted solution to minimize freeze-thaw cycles. |
Storage |
Lyophilized protein should be stored at < -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at < -20°C for 3 months. |
Purity |
Greater than 95% as determined by reducing SDS-PAGE. |
Endotoxin | Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test. |
Amino Acid Sequence |
QGERIIDGYKCKEGSHPWQVALLKGNQLHCGGVLVDKYWVLTAAHCKMGQYQVQLGSDKIGDQSA QKIKATKSFRHPGYSTKTHVNDIMLVRLDEPVKMSSKVEAVQLPEHCEPPGTSCTVSGWGTTTSP DVTFPSDLMCSDVKLISSRECKKVYKDLLGKTMLCAGIPDSKTNTCNGDSGGPLVCNDTLQGLVS WGTYPCGQPNDPGVYTQVCKYKRWVMETMKTHRVDHHHHHH
|
Background | Kallikrein7, also named as stratum corneum chymotryptic enzyme (SCCE), is a secreted protein of the Kallikrein-related peptidase (KLK) family. This family contains fifteen homologous secreted serine endopeptidases and plays a significant role in various physiological processes, including skin desquamation, semen liquefaction, neural plasticity, and body fluid homeostasis. In skin KLK5, KLK 7 and KLK14 are able to degrade corneodesmosomes, which leads to desquamation of skin surface cells. KLK activation is believed to be mediated through highly organized proteolytic cascades, regulated through a series of feedback loops, inhibitors, auto-degradation and internal cleavages. Studies have shown that one potential physiological activator for KLK7 is KLK5. Along with KLK14, these three kallikreins form a proteolytic cascade in the stratum corneum. KLK7 is primarily expressed in the skin but is also detected at relatively high levels in esophagus, heart, liver, central nervous system, kidney, pancreas, mammary and salivary glands. |