Recombinant Mouse B7-1/CD80

Instruction Manual!

Product name:	Recombinant Mouse B7-1/CD80
Source:	Human Cells
Purity:	Greater than 95% as determined by reducing SDS-PAGE.
Buffer Formulation:	Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4.
Applications:	Applications:SDS-PAGE; WB; ELISA; IP.
Storage:	Avoid repeated freeze/thaw cycles. Store at 2-8 oC for one month. Aliquot and store at -80 oC for 12 months.
UOM:	100ug/50ug/200ug/1mg/1g

Source	Human Cells
Description	Recombinant Mouse Activation B7-1 antigen is produced by our Mammalian expression system and the target gene encoding Val38-Lys245 is expressed with a Fc tag at the C-terminus.
Names	T-lymphocyte activation antigen CD80, Activation B7-1 antigen, B7, CD80
Accession #	Q00609
Formulation	Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4.
Shipping	The product is shipped at ambient temperature.
Reconstitution	Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 μg/ml. Dissolve the lyophilized protein in ddH2O. Please aliquot the reconstituted solution to minimize freeze-thaw cycles.
Storage	Lyophilized protein should be stored at < -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at < -20°C for 3 months.
Purity	Greater than 95% as determined by reducing SDS-PAGE.
Endotoxin	Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
Amino Acid Sequence	VDEQLSKSVKDKVLLPCRYNSPHEDESEDRIYWQKHDKVVLSVIAGKLKVWPEYKNRTLYDNTTY SLIILGLVLSDRGTYSCVVQKKERGTYEVKHLALVKLSIKADFSTPNITESGNPSADTKRITCFA SGGFPKPRFSWLENGRELPGINTTISQDPESELYTISSQLDFNTTRNHTIKCLIKYGDAHVSEDF TWEKPPEDPPDSKVDDIEGRMDEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPE VTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKV SNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPE NNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK
Background	Cluster of Differentiation 80, also called B7-1, is a member of cell surface immunoglobulin superfamily which plays key, yet distinct roles in the activation of T cells. It is the ligand for two different proteins on the T cell surface: CD28 and CTLA-4. Studies have shown that CTLA-4 binds mostly to CD80. The structure presents two extracellular domains: a membrane distal variable-like domain (IgV) and a membrane proximal Ig constant-like domain (IgC) along with an intracellular domain. Both IgV and IgC consist of anti-parallel beta sandwiches joined by a short linker region. CD80 is mostly expressed on the surface of antigen-presenting cells including activated B cells, macrophages and dendritic cells.