Recombinant Mouse C-X-C motif Chemokine 15/CXCL15/Lungkine

Instruction Manual!

Product name:	Recombinant Mouse C-X-C motif Chemokine 15/CXCL15/Lungkine
Source:	Human Cells
Purity:	Greater than 95% as determined by reducing SDS-PAGE.
Buffer Formulation:	Lyophilized from a 0.2 μm filtered solution of 20mM Tris,150mM NaCl,pH8.0.
Applications:	Applications:SDS-PAGE; WB; ELISA; IP.
Storage:	Avoid repeated freeze/thaw cycles. Store at 2-8 oC for one month. Aliquot and store at -80 oC for 12 months.
UOM:	100ug/50ug/200ug/1mg/1g

Source	Human Cells
Description	Recombinant Mouse C-X-C motif chemokine 15 is produced by our Mammalian expression system and the target gene encoding Gln26-Ala167 is expressed with a 6His tag at the C-terminus.
Names	C-X-C motif chemokine 15,Cxcl15,Lungkine,Small-inducible cytokine B15,Scyb15
Accession #	Q9WVL7
Formulation	Lyophilized from a 0.2 μm filtered solution of 20mM Tris,150mM NaCl,pH8.0.
Shipping	The product is shipped at ambient temperature.
Reconstitution	Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 μg/ml. Dissolve the lyophilized protein in ddH2O. Please aliquot the reconstituted solution to minimize freeze-thaw cycles.
Storage	Lyophilized protein should be stored at < -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at < -20°C for 3 months.
Purity	Greater than 95% as determined by reducing SDS-PAGE.
Endotoxin	Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
Amino Acid Sequence	QELRCLCIQEHSEFIPLKLIKNIMVIFETIYCNRKEVIAVPKNGSMICLDPDAPWVKATVGPITN RFLPEDLKQKEFPPAMKLLYSVEHEKPLYLSFGRPENKRIFPFPIRETSRHFADLAHNSDRNFLR DSSEVSLTGSDAVDHHHHHH
Background	Mouse C-X-C motif chemokine 15, also known as Cxcl15, is a secreted protein which is member of the ELR motif-containing CXC chemokines. It expressed at low levels in fetal lung, the expression restricted to the lung, produced by bronchoepithelial cells and is released into the airways. It plays an important role in lung-specific neutrophil trafficking during normal and inflammatory conditions. It also appears chemotactic for neutrophils.