elisa kit elisa kits logo

Tel:631-424-0089
Fax:631-424-0095
Email: info@immunoclone.com

Home>>Products >>  Proteins

Recombinant Mouse C-X-C motif Chemokine 15/CXCL15/Lungkine

Recombinant Mouse C-X-C motif Chemokine 15/CXCL15/Lungkine Recombinant Mouse C-X-C motif Chemokine 15/CXCL15/Lungkine

Instruction Manual!

Product name: Recombinant Mouse C-X-C motif Chemokine 15/CXCL15/Lungkine
Source:Human Cells
Purity:Greater than 95% as determined by reducing SDS-PAGE.
Buffer Formulation:Lyophilized from a 0.2 μm filtered solution of 20mM Tris,150mM NaCl,pH8.0.
Applications:Applications:SDS-PAGE; WB; ELISA; IP.
Storage:Avoid repeated freeze/thaw cycles. Store at 2-8 oC for one month. Aliquot and store at -80 oC for 12 months.
UOM:100ug/50ug/200ug/1mg/1g
Source Human Cells
Description Recombinant Mouse C-X-C motif chemokine 15 is produced by our Mammalian expression system and the target gene encoding Gln26-Ala167 is expressed with a 6His tag at the C-terminus.
Names C-X-C motif chemokine 15,Cxcl15,Lungkine,Small-inducible cytokine B15,Scyb15
Accession # Q9WVL7
Formulation Lyophilized from a 0.2 μm filtered solution of 20mM Tris,150mM NaCl,pH8.0.
Shipping The product is shipped at ambient temperature.
Reconstitution Always centrifuge tubes before opening. Do not mix by vortex or pipetting.
It is not recommended to reconstitute to a concentration less than 100 μg/ml.
Dissolve the lyophilized protein in ddH2O.
Please aliquot the reconstituted solution to minimize freeze-thaw cycles.
Storage Lyophilized protein should be stored at < -20°C, though stable at room temperature for 3 weeks.
Reconstituted protein solution can be stored at 4-7°C for 2-7 days.
Aliquots of reconstituted samples are stable at < -20°C for 3 months.
Purity Greater than 95% as determined by reducing SDS-PAGE.
Endotoxin Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
Amino Acid Sequence
QELRCLCIQEHSEFIPLKLIKNIMVIFETIYCNRKEVIAVPKNGSMICLDPDAPWVKATVGPITN RFLPEDLKQKEFPPAMKLLYSVEHEKPLYLSFGRPENKRIFPFPIRETSRHFADLAHNSDRNFLR DSSEVSLTGSDAVDHHHHHH
Background Mouse C-X-C motif chemokine 15, also known as Cxcl15, is a secreted protein which is member of the ELR motif-containing CXC chemokines. It expressed at low levels in fetal lung, the expression restricted to the lung, produced by bronchoepithelial cells and is released into the airways. It plays an important role in lung-specific neutrophil trafficking during normal and inflammatory conditions. It also appears chemotactic for neutrophils.

Copyright @ USA Immuno Clone Co., Ltd(I&C) All Rights Reserved Language:Chinese