Recombinant Mouse Carboxypeptidase A4/CPA4

Instruction Manual!

Product name:	Recombinant Mouse Carboxypeptidase A4/CPA4
Source:	Human Cells
Purity:	Greater than 95% as determined by reducing SDS-PAGE.
Buffer Formulation:	Supplied as a 0.2 μm filtered solution of 20mM TrisHCl, 150mM NaCl,10% Glycerol, pH8.0.
Applications:	Applications:SDS-PAGE; WB; ELISA; IP.
Storage:	Avoid repeated freeze/thaw cycles. Store at 2-8 oC for one month. Aliquot and store at -80 oC for 12 months.
UOM:	100ug/50ug/200ug/1mg/1g

Source	Human Cells
Description	Recombinant Mouse Carboxypeptidase A4 is produced by our Mammalian expression system and the target gene encoding Gly17-Tyr420 is expressed with a 6His tag at the C-terminus.
Names	CPA4/Carboxypeptidase A4
Accession #	Q6P8K8
Formulation	Supplied as a 0.2 μm filtered solution of 20mM TrisHCl, 150mM NaCl,10% Glycerol, pH8.0.
Shipping	The product is shipped on dry ice/ice packs.
Storage	Store at < -20°C, stable for 6 months after receipt. Please minimize freeze-thaw cycles.
Purity	Greater than 95% as determined by reducing SDS-PAGE.
Endotoxin	Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
Amino Acid Sequence	GRDKFFGDQVFRINVRNGDEIRKLTELVNSDHLKLSVWKSPSTFDRPVDILVPSVSLLPVKSFLK SQGLDYSVTIEDLQALLDNEDEEMQHNEGIERSGDFNYGAYHPLEAIYHEMDSIATDFPELVSRV KIGETFEKRPMYVLKFSTGGGKKRPAIWLNAGIHAREWISQATAIWTARKIVTDYKKDPAITSIL KKVDIFLLPVANPDGYVYTQSQNRLWRKTRSRNPGSRCVGADPNRNWNASFAGEGTSDNPCSEVY HGSHPNSEVEVKSVVDFIQKHGNFKCFIDLHSYSQLLMYPYGYTVKKAPDAEELDDVARNAAQAL ASLSGTKYRVGPTCTTVYPASGSSVDWAYDNGIKYAFTFELRDTGYYGFLLPASQIIPTAEETWL GLKTIMEHVRDHLYVDHHHHHH
Background	Carboxypeptidase A4 (CPA4) is a member of the peptidase M14 family. CPA4 is metalloprotease that could be involved in the histone hyperacetylation pathway. CPA4 binds one zinc ion per subunit and could catalyze to release of a C-terminal amino acid, with preference for -Phe, -Leu, -Ile, -Met, -Tyr and -Val.They have distinct expression patterns and different specificities for example, preferentially cleaving aromatic (carboxypeptidase As) or basic (carboxypeptidase Bs) residues. Several, such as carboxypeptidase Xs, have lost their catalytic activity. Carboxypeptidases play important roles in digestion of food, processing of bioactive peptides and blood coagulation.