Recombinant Mouse Dickkopf-Like Protein 1/DkkL1/Soggy-1

Instruction Manual!

Product name:	Recombinant Mouse Dickkopf-Like Protein 1/DkkL1/Soggy-1
Source:	Human Cells
Purity:	Greater than 95% as determined by reducing SDS-PAGE.
Buffer Formulation:	Greater than 95% as determined by reducing SDS-PAGE.
Applications:	Applications:SDS-PAGE; WB; ELISA; IP.
Storage:	Avoid repeated freeze/thaw cycles. Store at 2-8 oC for one month. Aliquot and store at -80 oC for 12 months.
UOM:	100ug/50ug/200ug/1mg/1g

Source	Human Cells
Description	Recombinant Mouse Dickkopf-like protein 1 is produced by our Mammalian expression system and the target gene encoding Leu21-Leu230 is expressed with a 6His tag at the C-terminus.
Names	Dickkopf-like protein 1, Protein soggy-1, SGY-1, Dkkl1，Soggy-1
Accession #	Q9QZL9
Formulation	Lyophilized from a 0.2 μm filtered solution of PBS,pH7.4.
Shipping	The product is shipped at ambient temperature.
Reconstitution	Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 μg/ml. Dissolve the lyophilized protein in ddH2O. Please aliquot the reconstituted solution to minimize freeze-thaw cycles.
Storage	Lyophilized protein should be stored at < -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at < -20°C for 3 months.
Purity	Greater than 95% as determined by reducing SDS-PAGE.
Endotoxin	Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
Amino Acid Sequence	LPIHDVDSQQNTSGFLGLQRLLQSFSRLFLKNDLLRDLDNFFSSPMDFRDLPRNFHQEENQEHRM GNHTLSSHLQIDKVTDNQTGEVLISEKVEASIEPERNPEGDWKVPKVEAKEPPVPVQKVTDSLHP EPRQVAFWIMKMPRRRTQPDVQDGGRWLIEKRHRMQAIRDGLRGGAREDSLEDGVHIPQHAKLPV RKTHFLYILRPSQQLVDHHHHHH
Background	The glycoprotein Dickkopf-like1, also known as soggy-1, is a member of Dickkopf (Dkk) family which modulates Wnt signaling by binding to the Wnt co-receptor lipoprotein receptor-related protein (Lrp) via two Cys-rich regions. Dkkl1 shows unique homology to a discrete region in Dkk3, however, it lacks the Lrp binding region that enables Wnt modulation. Dkkl1 expression is gradually upregulated during the development of mouse testis and corresponds to the mouse spermatogenesis. Mouse Dkkl1 is detected in the embryo, as well as in the developing skeleton, eyes and neural tissue. In adult animals the expression of Dkkl1 is specific for spermatocytes and spermatids, where it regulates spermatocyte apoptosis mediated by Fas death ligand (FasL). Dkkl1 plays a critical role in male mammalian spermatogenesis.