Recombinant Mouse Carboxylesterase 2E/CES2E
Product name: | Recombinant Mouse Carboxylesterase 2E/CES2E |
Source: | Human Cells |
Purity: | Greater than 95% as determined by reducing SDS-PAGE. |
Buffer Formulation: | Lyophilized from a 0.2 μm filtered solution of 20mM PB, 150mM NaCl, pH7.4. |
Applications: | Applications:SDS-PAGE; WB; ELISA; IP. |
Storage: | Avoid repeated freeze/thaw cycles. Store at 2-8 oC for one month. Aliquot and store at -80 oC for 12 months. |
UOM: | 100ug/50ug/200ug/1mg/1g |
Source | Human Cells |
Description | Recombinant Mouse Carboxylesterase 2E is produced by our Mammalian expression system and the target gene encoding Met1-His556 is expressed with a 6His tag at the C-terminus. |
Names | Pyrethroid hydrolase Ces2e, carboxylesterase 2E, Ces5 |
Accession # | Q8BK48 |
Formulation | Lyophilized from a 0.2 μm filtered solution of 20mM PB, 150mM NaCl, pH7.4. |
Shipping |
The product is shipped at ambient temperature. |
Reconstitution |
Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 μg/ml. Dissolve the lyophilized protein in ddH2O. Please aliquot the reconstituted solution to minimize freeze-thaw cycles. |
Storage |
Lyophilized protein should be stored at < -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at < -20°C for 3 months. |
Purity |
Greater than 95% as determined by reducing SDS-PAGE. |
Endotoxin | Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test. |
Amino Acid Sequence |
MPLYKLLGWLNAVACGVLLLVLHVQGQDSASPIRNTHTGQVRGSLVHVKDTDIAVHTFLGIPFAK PPVGPLRFAPPEAPEPWSGVRDGTSHPNMCLQNDNLMGSEDLKMMNLILPPISMSEDCLYLNIYV PAHAHEGSNLPVMVWIHGGALTVGMASMYDGSMLAATEDVVVVAIQYRLGVLGFFSTGDQHAKGN WGYLDQVAALRWVQQNIVHFGGNPDRVTIFGESAGGTSVSSHVVSPMSQGLFHGAIMESGVAVLP DLISSSSEMVHRIVANLSGCAAVNSETLMCCLRGKNEAEMLAINKVFKIIPGVVDGEFLPKHPQE LMASKDFHPVPSIIGINNDEYGWILPTIMDPAQKIEEITRKTLPAVLKSTALKMMLPPECGDLLM EEYMGDTEDPETLQAQFREMKGDFMFVIPALQVAHFQRSHAPVYFYEFQHRPSFFKDFRPPYVKA DHGDEIFLVFGYQFGNIKLPYTEEEEQLSRRIMKYWANFARHGNPNSEGLPYWPVMDHDEQYLQL DIQPSVGRALKARRLQFWTKTLPQKIQELKGSQERHVDHHHHHH
|
Background | Carboxylesterase 5 (CES5), also called cauxin or CES7, is a member of carboxylesterases family which plays an important role in the hydrolysis of ester and amide bonds. Carboxylesterase is a type of enzyme that capable of hydrolyzing a variety of carboxylic acid esters and it's widely distributed in cells especially in mammalian liver. CES5 is with broad substrate specificity ranging from small molecule esters to longchain fatty acid esters and thioesters. It has been previously reported CES5 was in high concentrations in the urine (cauxin) of adult male cats, and within a protein complex of mammalian male epididymal fluids. Roles for CES5 may include regulating urinary levels of male cat pheromones, catalyzing lipid transfer reactions within mammalian male reproductive fluids, and protecting neural tissue from drugs and xenobiotics. |