Recombinant Mouse IL-2R α/IL-2RA/CD25

Instruction Manual!

Product name:	Recombinant Mouse IL-2R α/IL-2RA/CD25
Source:	Human Cells
Purity:	Greater than 95% as determined by reducing SDS-PAGE.
Buffer Formulation:	Lyophilized from a 0.2 μm filtered solution of PBS, pH7.4.
Applications:	Applications:SDS-PAGE; WB; ELISA; IP.
Storage:	Avoid repeated freeze/thaw cycles. Store at 2-8 oC for one month. Aliquot and store at -80 oC for 12 months.
UOM:	100ug/50ug/200ug/1mg/1g

Source	Human Cells
Description	Recombinant Mouse Interleukin-2 receptor subunit alpha is produced by our Mammalian expression system and the target gene encoding Glu22-Lys236 is expressed with a Fc tag at the C-terminus.
Names	CD25; IL-2 R alpha; IL2RA; CD25 antigen; IDDM10; IL-2 receptor subunit alpha; IL2R; IL-2R subunit alpha; IL-2-RA; IL2-RA; interleukin 2 receptor; alpha; interleukin-2 receptor subunit alpha; p55; TAC antigen; TCGFR
Accession #	P01590
Formulation	Lyophilized from a 0.2 μm filtered solution of PBS, pH7.4.
Shipping	The product is shipped at ambient temperature.
Reconstitution	Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 μg/ml. Dissolve the lyophilized protein in ddH2O. Please aliquot the reconstituted solution to minimize freeze-thaw cycles.
Storage	Lyophilized protein should be stored at < -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at < -20°C for 3 months.
Biological Activity	IN STOCK
Purity	Greater than 95% as determined by reducing SDS-PAGE.
Endotoxin	Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
Amino Acid Sequence	ELCLYDPPEVPNATFKALSYKNGTILNCECKRGFRRLKELVYMRCLGNSWSSNCQCTSNSHDKSR KQVTAQLEHQKEQQTTTDMQKPTQSMHQENLTGHCREPPPWKHEDSKRIYHFVEGQSVHYECIPG YKALQRGPAISICKMKCGKTGWTQPQLTCVDEREHHRFLASEESQGSRNSSPESETSCPITTTDF PQPTETTAMTETFVLTMEYKDIEGRMDEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMI SRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKE YKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWES NGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK
Background	The interleukin 2 receptor alpha (IL2RA), also called CD25, is a type I transmembrane protein that presents on activated T cells, activated B cells, some thymocytes, myeloid precursors, and oligodendrocytes. IL2RA is a member of cytokine receptors family that utilizes the common gamma chain subunit (γc). IL2RA is expressed in most B-cell neoplasms, some acute nonlymphocytic leukemias, neuroblastomas, and tumor infiltrating lymphocytes. IL2RA associates with IL2RB (CD122) to form a heterodimer that can act as a high-affinity receptor for IL-2.