Recombinant Mouse Transforming Growth Factor-β Receptor Type II/TGFBR2

Instruction Manual!

Product name:	Recombinant Mouse Transforming Growth Factor-β Receptor Type II/TGFBR2
Source:	Human Cells
Purity:	Greater than 95% as determined by reducing SDS-PAGE.
Buffer Formulation:	Lyophilized from a 0.2 μm filtered solution of PBS,pH7.4.
Applications:	Applications:SDS-PAGE; WB; ELISA; IP.
Storage:	Avoid repeated freeze/thaw cycles. Store at 2-8 oC for one month. Aliquot and store at -80 oC for 12 months.
UOM:	100ug/50ug/200ug/1mg/1g

Source	Human Cells
Description	Recombinant Mouse TGF beta receptor II is produced by our Mammalian expression system and the target gene encoding Ile24-Asp159 is expressed with a 6His tag at the C-terminus.
Names	TGF-beta receptor type-2, TGFR-2, TGF-beta type II receptor, Transforming growth factor-beta receptor type II, TGF-beta receptor type II, TbetaR-II, Tgfbr2
Accession #	Q62312-2
Formulation	Lyophilized from a 0.2 μm filtered solution of PBS,pH7.4.
Shipping	The product is shipped at ambient temperature.
Reconstitution	Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 μg/ml. Dissolve the lyophilized protein in ddH2O. Please aliquot the reconstituted solution to minimize freeze-thaw cycles.
Storage	Lyophilized protein should be stored at < -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at < -20°C for 3 months.
Purity	Greater than 95% as determined by reducing SDS-PAGE.
Endotoxin	Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
Amino Acid Sequence	IPPHVPKSVNSDVMASDNGGAVKLPQLCKFCDVRLSTCDNQKSCMSNCSITAICEKPHEVCVAVW RKNDKNITLETVCHDPKLTYHGFTLEDAASPKCVMKEKKRAGETFFMCACNMEECNDYIIFSEEY TTSSPDVDHHHHHH
Background	Transforming growth factor-β (TGF-β) is an essential regulator in the processes of development, cell proliferation, and extracellular matrix deposition. TGF-β regulates cellular processes by binding to three high-affinity cell surface receptors: TGF-β receptor type I (TGF-β-RI), TGF-β receptor type II (TGF-β-RII), and TGF-ββ receptor type III (TGF-β-RIII). TGF-β RII is consists of a C-terminal protein kinase domain and an N-terminal ectodomain and belongs to transforming growth factor-beta (TGF-β) receptor subfamily. TGF-β RII has a protein kinase domain which can form a heterodimeric complex with another receptor protein and bind TGF-beta. This receptor/ligand complex phosphorylates protein will enter the nucleus and regulate the transcription of a subset of genes related to cell proliferation.