Recombinant Mouse Thymic Stromal Lymphopoietin Receptor/TSP R
| Product name: | Recombinant Mouse Thymic Stromal Lymphopoietin Receptor/TSP R |
| Source: | Human Cells |
| Purity: | Greater than 95% as determined by reducing SDS-PAGE. |
| Buffer Formulation: | Lyophilized from a 0.2 μm filtered solution of 20mM PB, 150mM NaCl, pH 7.4. |
| Applications: | Applications:SDS-PAGE; WB; ELISA; IP. |
| Storage: | Avoid repeated freeze/thaw cycles. Store at 2-8 oC for one month. Aliquot and store at -80 oC for 12 months. |
| UOM: | 100ug/50ug/200ug/1mg/1g |
| Source | Human Cells |
| Description | Recombinant Mouse Thymic stromal lymphopoietin protein receptor is produced by our Mammalian expression system and the target gene encoding Ala20-Leu233 is expressed with a 6His tag at the C-terminus. |
| Names | CRL2, CRLF2, CRLM-2, PCOR1, CRL2 cytokine receptor, CRL2 precusor, CRLF2Y, Cytokine receptor-like 2, cytokine receptor-like factor 2, ILXR, IL-XR, P2RY8/CRLF2 fusion, Thymic stromal lymphopoietin protein receptor, Thymic stromal-derived lymphopoietin receptor, TSLP receptor, TSLPR |
| Accession # | Q8CII9 |
| Formulation | Lyophilized from a 0.2 μm filtered solution of 20mM PB, 150mM NaCl, pH 7.4. |
| Shipping |
The product is shipped at ambient temperature. |
| Reconstitution |
Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 μg/ml. Dissolve the lyophilized protein in ddH2O. Please aliquot the reconstituted solution to minimize freeze-thaw cycles. |
| Storage |
Lyophilized protein should be stored at < -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at < -20°C for 3 months. |
| Purity |
Greater than 95% as determined by reducing SDS-PAGE. |
| Endotoxin | Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test. |
| Amino Acid Sequence |
AAAVTSRGDVTVVCHDLETVEVTWGSGPDHHSANLSLEFRYGTGALQPCPRYFLSGAGVTSGCIL PAARAGLLELALRDGGGAMVFKARQRASAWLKPRPPWNVTLLWTPDGDVTVSWPAHSYLGLDYEV QHRESNDDEDAWQTTSGPCCDLTVGGLDPARCYDFRVRASPRAAHYGLEAQPSEWTAVTRLSGAA SAASCTASPAPSPALAPPLVDHHHHHH
|
| Background | The cytokine thymic stromal lymphopoietin receptor (TSLPR) is consisting of a common γ receptor–like chain (TSLPR-γ) and a common interleukin 7 (IL-7) Rα chain that belongs to the type 1 cytokine receptor family. Transfection of TSLPR cDNA result in only low affinity binding, while cotransfection of the IL-7Rα chain cDNA shows high affinity binding. TSLP and TSLPR play a critical role in the initiation of allergic diseases in mice. The TSLP R cDNA encodes a transmembrane receptor containing 370 amino acids (aa) with two potential N-linked glycosylation sites and a cytoplasmic domain of 104 aa including a single tyrosine residue. TSLPR can mediate signaling of the signal transducer and activator of transcription 5 (Stat5) by TSLP. TSLP R is broadly expressed in the immune and hematopoietic cells, particularly in hematopoietic progenitors and myeloid cells. |












