Recombinant Mouse Serpin D1/Heparin Cofactor II/HCF2

Instruction Manual!

Product name:	Recombinant Mouse Serpin D1/Heparin Cofactor II/HCF2
Source:	Human Cells
Purity:	Greater than 95% as determined by reducing SDS-PAGE.
Buffer Formulation:	Lyophilized from a 0.2 μm filtered solution of 20mM HEPES,150mM NaCl,pH7.4.
Applications:	Applications:SDS-PAGE; WB; ELISA; IP.
Storage:	Avoid repeated freeze/thaw cycles. Store at 2-8 oC for one month. Aliquot and store at -80 oC for 12 months.
UOM:	100ug/50ug/200ug/1mg/1g

Source	Human Cells
Description	Recombinant Mouse Serpin D1/Heparin cofactor 2/HCF2 is produced by our Mammalian expression system and the target gene encoding Glu24-Ser478 is expressed with a 6His tag at the C-terminus.
Names	Heparin cofactor 2, Heparin cofactor II, HC-II, Protease inhibitor leuserpin-2, Serpin D1
Accession #	P49182
Formulation	Lyophilized from a 0.2 μm filtered solution of 20mM HEPES,150mM NaCl,pH7.4.
Shipping	The product is shipped at ambient temperature.
Reconstitution	Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 μg/ml. Dissolve the lyophilized protein in ddH2O. Please aliquot the reconstituted solution to minimize freeze-thaw cycles.
Storage	Lyophilized protein should be stored at < -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at < -20°C for 3 months.
Purity	Greater than 95% as determined by reducing SDS-PAGE.
Endotoxin	Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
Amino Acid Sequence	EQLTNENLTTSFLPANFHKENTVTNDWIPEGEEDEDYLDLEKLLGEDDDYIYIIDAVSPTDSESS AGNILQLFQGKSRIQRLNILNAKFAFNLYRVLKDQATTSDNLFIAPVGISTAMGMISLGLRGETH EEVHSVLHFRDFVNASSKYEVTTIHNLFRKLTHRLFRRNFGYTLRSVNGLYIQKQFPIREDFKAA MREFYFAEAQEANFPDPAFISKANNHILKLTKGLIKEALENIDPATQMLILNCIYFKGTWVNKFP VEMTHNHNFRLNEREVVKVSMMQTKGNFLAANDQELDCDILQLEYVGGISMLIVVPRKLSGMKTL EAQLTPQVVERWQKSMTNRTREVLLPKFKLEKNYNLVEVLKSMGITKLFNKNGNMSGISDQRIAI DLFKHQSTITVNEEGTQAAAVTTVGFMPLSTQVRFTVDRPFLFLVYEHRTSCLLFMGKVTNPAKS VDHHHHHH
Background	SerpinD1, also known as heparin cofactor II(HC-II), is a member of Serpin superfamily of the serine proteinase inhibitors. It is a single chain glycoprotein with a size of 66.5 kDa and is secreted from hepatocytes. HC-II acts as a thrombin inhibitor in the coagulation cascade, in a glycosaminoglycan-dependent pathway using the release of a sequestered hirudin-like N-terminal tail for interaction with thrombin. This serpin belongs to multiple member group V2 of vertebrate serpin classification. It has been suggested that HC-II is a predictor of decreased atherosclerosis in the elderly and protective against atherosclerosis in mice. HCII can used as a predictive biomarker and therapeutic target for atherosclerosis.