Recombinant Mouse Serum Amyloid P Component/SAP/Pentraxin 2
Product name: | Recombinant Mouse Serum Amyloid P Component/SAP/Pentraxin 2 |
Source: | Human Cells |
Purity: | Greater than 95% as determined by reducing SDS-PAGE. |
Buffer Formulation: | Lyophilized from a 0.2 μm filtered solution of PBS,pH7.4. |
Applications: | Applications:SDS-PAGE; WB; ELISA; IP. |
Storage: | Avoid repeated freeze/thaw cycles. Store at 2-8 oC for one month. Aliquot and store at -80 oC for 12 months. |
UOM: | 100ug/50ug/200ug/1mg/1g |
Source | Human Cells |
Description | Recombinant Mouse Serum Amyloid P Component is produced by our Mammalian expression system and the target gene encoding Gln21-Asp224 is expressed with a 6His tag at the C-terminus. |
Names | APCS, PTX2, SAP, 9.5S alpha-1-glycoprotein, Serum amyloid P, MGC88159, PTX2serum amyloid P-component, SAP pentaxin-related |
Accession # | P12246 |
Formulation | Lyophilized from a 0.2 μm filtered solution of PBS,pH7.4. |
Shipping |
The product is shipped at ambient temperature. |
Reconstitution |
Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 μg/ml. Dissolve the lyophilized protein in ddH2O. Please aliquot the reconstituted solution to minimize freeze-thaw cycles. |
Storage |
Lyophilized protein should be stored at < -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at < -20°C for 3 months. |
Purity |
Greater than 95% as determined by reducing SDS-PAGE. |
Endotoxin | Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test. |
Amino Acid Sequence |
QTDLKRKVFVFPRESETDHVKLIPHLEKPLQNFTLCFRTYSDLSRSQSLFSYSVKGRDNELLIYK EKVGEYSLYIGQSKVTVRGMEEYLSPVHLCTTWESSSGIVEFWVNGKPWVKKSLQREYTVKAPPS IVLGQEQDNYGGGFQRSQSFVGEFSDLYMWDYVLTPQDILFVYRDSPVNPNILNWQALNYEINGY VVIRPRVWDVDHHHHHH
|
Background | Pentraxin 2 (PTX2), also known as Serum amyloid P (SAP), is a highly conserved, naturally circulating plasma protein and a soluble pattern recognition receptor of the innate immune system. The unique binding activities indicated that it may play an important role in the removal of damaged tissue. PTX2 belongs to the pentraxin family, is universally present in amyloid deposits. Mouse with targeted deletion of the PTX2 gene shows retarded and reduced induction of experimental reactive systemic (AA type) amyloidosis confirmed that it does indeed contribute to pathogenesis of amyloidosis and is a valid therapeutic target. In recent discovery, PTX2 can be used as a powerful antifibrotic agent to regulate certain monocyte differentiation states. |