Recombinant Mouse TREML2/TLT-2

Instruction Manual!

Product name:	Recombinant Mouse TREML2/TLT-2
Source:	Human Cells
Purity:	Greater than 95% as determined by reducing SDS-PAGE.
Buffer Formulation:	Lyophilized from a 0.2 μm filtered solution of PBS, pH7.4.
Applications:	Applications:SDS-PAGE; WB; ELISA; IP.
Storage:	Avoid repeated freeze/thaw cycles. Store at 2-8 oC for one month. Aliquot and store at -80 oC for 12 months.
UOM:	100ug/50ug/200ug/1mg/1g

Source	Human Cells
Description	Recombinant Mouse TREML2 is produced by our Mammalian expression system and the target gene encoding His25-Ala270 is expressed with a 6His tag at the C-terminus.
Names	Trem-like transcript 2 protein, TLT-2, Triggering receptor expressed on myeloid cells-like protein 2, TREML2, TLT2
Accession #	Q2LA85
Formulation	Lyophilized from a 0.2 μm filtered solution of PBS, pH7.4.
Shipping	The product is shipped at ambient temperature.
Reconstitution	Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 μg/ml. Dissolve the lyophilized protein in ddH2O. Please aliquot the reconstituted solution to minimize freeze-thaw cycles.
Storage	Lyophilized protein should be stored at < -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at < -20°C for 3 months.
Purity	Greater than 95% as determined by reducing SDS-PAGE.
Endotoxin	Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
Amino Acid Sequence	HSNENLYRKVWRREGETLSVQCSYKNRRNLVEAKSWCKVKKKKCDHNFTRSWVRGPSYSLRDDAK VKVVRITMEALRVQDSGRYWCMRNTAGHFYPLVGFQLEVYPALTTERNVPHTHLTNTPMDGFVTT GQVHISDPHAPFTSDVTMFTSEVTMFTSGLLTLASGTTTPTPVTGYSFIDTSGTVTEPERNTESQ PATLSPSNARSFSADPVTTSTMSRHQSSSLSTTGTCHPLTPNRSQETYIPAHHHHHH
Background	Trem-like transcript 2 protein (TLT2), also known as Triggering receptor expressed on myeloid cells-like protein 2, TLT2 and C6orf76, is single-pass type I membrane protein. TREML2 contains one Ig-like V-type domain, which can be induced in CD4 T-cell by concanavalin-A. As a cell surface receptor, TREML2 may play a role in the innate and adaptive immune response. TREML2 also acts as a counter-receptor for CD276 and interaction with CD276 on T-cells enhances T-cell activation. It has shown that TREML2 may be involved in the innate immune response based on its expression profile and the fact that it is up-regulated in response to inflammation.