Recombinant Mouse Follistatin-Like 1/FSTL1

Instruction Manual!

Product name:	Recombinant Mouse Follistatin-Like 1/FSTL1
Source:	Human Cells
Purity:	Greater than 95% as determined by reducing SDS-PAGE.
Buffer Formulation:	Lyophilized from a 0.2 μm filtered solution of PBS, pH7.4.
Applications:	Applications:SDS-PAGE; WB; ELISA; IP.
Storage:	Avoid repeated freeze/thaw cycles. Store at 2-8 oC for one month. Aliquot and store at -80 oC for 12 months.
UOM:	100ug/50ug/200ug/1mg/1g

Source	Human Cells
Description	Recombinant Mouse Follistatin-like Protein 1 is produced by our Mammalian expression system and the target gene encoding Glu19-Ile306 is expressed with a 6His tag at the C-terminus.
Names	Follistatin-related protein 1, Follistatin-like protein 1, TGF-beta-inducible protein TSC-36, Fstl1
Accession #	Q62356
Formulation	Lyophilized from a 0.2 μm filtered solution of PBS, pH7.4.
Shipping	The product is shipped at ambient temperature.
Reconstitution	Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 μg/ml. Dissolve the lyophilized protein in ddH2O. Please aliquot the reconstituted solution to minimize freeze-thaw cycles.
Storage	Lyophilized protein should be stored at < -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at < -20°C for 3 months.
Purity	Greater than 95% as determined by reducing SDS-PAGE.
Endotoxin	Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
Amino Acid Sequence	EEEPRSKSKICANVFCGAGRECAVTEKGEPTCLCIEQCKPHKRPVCGSNGKTYLNHCELHRDACL TGSKIQVDYDGHCKEKKSASPSASPVVCYQANRDELRRRLIQWLEAEIIPDGWFSKGSNYSEILD KYFKSFDNGDSHLDSSEFLKFVEQNETAINITTYADQENNKLLRSLCVDALIELSDENADWKLSF QEFLKCLNPSFNPPEKKCALEDETYADGAETEVDCNRCVCSCGHWVCTAMTCDGKNQKGVQTHTE EEKTGYVQELQKHQGTAEKTKKVNTKEIVDHHHHHH
Background	Follistatin-like 1 (FSTL1) is a secreted glycoprotein that has been grouped into the follistatin family of proteins. FSTL1 is composed of a follistatin domain and two non-functional calcium-binding motifs. It was originally cloned as a TGFβ1 inducible factor but subsequently shown to regulate diverse developmental pathways and tissue homeostasis. Ablation of the FSTL1 gene in the mouse results in several structural developmental defects and neonatal lethality due to respiratory failure. FSTL1 suppresses BMP signaling, but the precise mechanism of its action has not been elucidated. FSTL1 is expressed in the human placenta, mainly in extravillous trophoblasts.