Recombinant Mouse Granzyme D/GZMD

Instruction Manual!

Product name:	Recombinant Mouse Granzyme D/GZMD
Source:	Human Cells
Purity:	Greater than 95% as determined by reducing SDS-PAGE.
Buffer Formulation:	Lyophilized from a 0.2 μm filtered solution of 20mM HEPES, 150mM NaCl, pH7.4.
Applications:	Applications:SDS-PAGE; WB; ELISA; IP.
Storage:	Avoid repeated freeze/thaw cycles. Store at 2-8 oC for one month. Aliquot and store at -80 oC for 12 months.
UOM:	100ug/50ug/200ug/1mg/1g

Source	Human Cells
Description	Recombinant Mouse Granzyme D is produced by our Mammalian expression system and the target gene encoding Ile21-Leu252 is expressed with a 6His tag at the C-terminus.
Names	Granzyme D, Gzmd
Accession #	P11033
Formulation	Lyophilized from a 0.2 μm filtered solution of 20mM HEPES, 150mM NaCl, pH7.4.
Shipping	The product is shipped at ambient temperature.
Reconstitution	Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 μg/ml. Dissolve the lyophilized protein in ddH2O. Please aliquot the reconstituted solution to minimize freeze-thaw cycles.
Storage	Lyophilized protein should be stored at < -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at < -20°C for 3 months.
Purity	Greater than 95% as determined by reducing SDS-PAGE.
Endotoxin	Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
Amino Acid Sequence	IIGGHVVKPHSRPYMAFVMSVDIKGNRIYCGGFLIQDDFVLTAAHCKNSSVQSSMTVTLGAHNIT AKEETQQIIPVAKDIPHPDYNATIFYSDIMLLKLESKAKRTKAVRPLKLPRSNARVKPGDVCSVA GWGSRSINDTKASARLREVQLVIQEDEECKKRFRYYTETTEICAGDLKKIKTPFKGDSGGPLVCD NQAYGLFAYAKNGTISSGIFTKVVHFLPWISWNMKLLVDHHHHHH
Background	Granzyme D is a member of the granzyme family of the serine proteases which plays a role in the induction of apoptosis. T cells, lymphohematopoietic stromal cells, and granulated metrial gland cells express granzyme D, but the function of granzyme D is unknown. Previous studies reported that granzyme D is developmentally regulated during pregnancy together with granzymes E, F, and G in granulated metrial gland cells and is upregulated by IL-2 and IL-15. Granzyme D was also suggested to have a role in stromal cell-lymphocyte interactions.