elisa kit elisa kits logo

Tel:631-424-0089
Fax:631-424-0095
Email: info@immunoclone.com

Home>>Products >>  Proteins

Recombinant Mouse Tyrosine-Protein Kinase Receptor TYRO3/Dtk

Recombinant Mouse Tyrosine-Protein Kinase Receptor TYRO3/Dtk Recombinant Mouse Tyrosine-Protein Kinase Receptor TYRO3/Dtk

Instruction Manual!

Product name: Recombinant Mouse Tyrosine-Protein Kinase Receptor TYRO3/Dtk
Source:Human Cells
Purity:Greater than 95% as determined by reducing SDS-PAGE.
Buffer Formulation:Lyophilized from a 0.2 μm filtered solution of PBS,pH7.4.
Applications:Applications:SDS-PAGE; WB; ELISA; IP.
Storage:Avoid repeated freeze/thaw cycles. Store at 2-8 oC for one month. Aliquot and store at -80 oC for 12 months.
UOM:100ug/50ug/200ug/1mg/1g
Source Human Cells
Description Recombinant Mouse Dtk is produced by our Mammalian expression system and the target gene encoding Ala31-Ser418 is expressed with a mFc tag at the C-terminus.
Names Tyrosine-protein kinase receptor TYRO3,Tyro3,Etk2/tyro3,TK19-2,Tyrosine-protein kinase DTK,Tyrosine-protein kinase RSE,Tyrosine-protein kinase TIF
Accession # P55144
Formulation Lyophilized from a 0.2 μm filtered solution of PBS,pH7.4.
Shipping The product is shipped at ambient temperature.
Reconstitution Always centrifuge tubes before opening. Do not mix by vortex or pipetting.
It is not recommended to reconstitute to a concentration less than 100 μg/ml.
Dissolve the lyophilized protein in ddH2O.
Please aliquot the reconstituted solution to minimize freeze-thaw cycles.
Storage Lyophilized protein should be stored at < -20°C, though stable at room temperature for 3 weeks.
Reconstituted protein solution can be stored at 4-7°C for 2-7 days.
Aliquots of reconstituted samples are stable at < -20°C for 3 months.
Purity Greater than 95% as determined by reducing SDS-PAGE.
Endotoxin Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
Amino Acid Sequence
AGLKLMGAPVKMTVSQGQPVKLNCSVEGMEDPDIHWMKDGTVVQNASQVSISISEHSWIGLLSLK SVERSDAGLYWCQVKDGEETKISQSVWLTVEGVPFFTVEPKDLAVPPNAPFQLSCEAVGPPEPVT IYWWRGLTKVGGPAPSPSVLNVTGVTQRTEFSCEARNIKGLATSRPAIVRLQAPPAAPFNTTVTT ISSYNASVAWVPGADGLALLHSCTVQVAHAPGEWEALAVVVPVPPFTCLLRNLAPATNYSLRVRC ANALGPSPYGDWVPFQTKGLAPARAPQNFHAIRTDSGLILEWEEVIPEDPGEGPLGPYKLSWVQE NGTQDELMVEGTRANLTDWDPQKDLILRVCASNAIGDGPWSQPLVVSSHDHAGRQGPPHSRTSGG GGSGGGGSGGGGSPRDCGCKPCICTVPEVSSVFIFPPKPKDVLTITLTPKVTCVVVDISKDDPEV QFSWFVDDVEVHTAQTQPREEQFNSTFRSVSELPIMHQDWLNGKEFKCRVNSAAFPAPIEKTISK TKGRPKAPQVYTIPPPKEQMAKDKVSLTCMITDFFPEDITVEWQWNGQPAENYKNTQPIMDTDGS YFVYSKLNVQKSNWEAGNTFTCSVLHEGLHNHHTEKSLSHSPGK
Background Dtk, also called Tyro3, belongs to the TAM receptor family of receptor protein tyrosine kinases (RPTKs) composed of three receptors Tyro3, Axl, and Mer. These receptors share a characteristic molecular structure of two immunoglobulin-like and two fibronectin type III repeats and have been best characterized for their roles in immune regulation, fertility, thrombosis and phagocytosis. Gas6 and protein S have been identified as ligands for these receptors. Gas6 binding induces tyrosine phosphorylation and downstream signaling pathways that can lead to cell proliferation, migration, or the prevention of apoptosis. Tyro3 and Axl play important regulatory roles in a variety of tissues, including the central nervous, reproductive, immune, and vascular systems. Tyro3 is widely expressed during embryonic development and preferentially expressed during neurogenesis in the central nervous system.

Copyright @ USA Immuno Clone Co., Ltd(I&C) All Rights Reserved Language:Chinese