elisa kit elisa kits logo

Tel:631-424-0089
Fax:631-424-0095
Email: info@immunoclone.com

Home>>Products >>  Proteins

Recombinant Mouse Interleukin-11/IL-11

Recombinant Mouse Interleukin-11/IL-11 Recombinant Mouse Interleukin-11/IL-11

Instruction Manual!

Product name: Recombinant Mouse Interleukin-11/IL-11
Source:Human Cells
Purity:Greater than 95% as determined by reducing SDS-PAGE.
Buffer Formulation:Lyophilized from a 0.2 μm filtered solution of PBS,pH7.4.
Applications:Applications:SDS-PAGE; WB; ELISA; IP.
Storage:Avoid repeated freeze/thaw cycles. Store at 2-8 oC for one month. Aliquot and store at -80 oC for 12 months.
UOM:100ug/50ug/200ug/1mg/1g
Source Human Cells
Description Recombinant Mouse Interleukin-11 is produced by our Mammalian expression system and the target gene encoding Pro22-Leu199 is expressed with a Fc tag at the C-terminus.
Names Interleukin-11,Il11,IL-11
Accession # P47873
Formulation Lyophilized from a 0.2 μm filtered solution of PBS,pH7.4.
Shipping The product is shipped at ambient temperature.
Reconstitution Always centrifuge tubes before opening. Do not mix by vortex or pipetting.
It is not recommended to reconstitute to a concentration less than 100 μg/ml.
Dissolve the lyophilized protein in ddH2O.
Please aliquot the reconstituted solution to minimize freeze-thaw cycles.
Storage Lyophilized protein should be stored at < -20°C, though stable at room temperature for 3 weeks.
Reconstituted protein solution can be stored at 4-7°C for 2-7 days.
Aliquots of reconstituted samples are stable at < -20°C for 3 months.
Purity Greater than 95% as determined by reducing SDS-PAGE.
Endotoxin Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
Amino Acid Sequence
PGPPAGSPRVSSDPRADLDSAVLLTRSLLADTRQLAAQMRDKFPADGDHSLDSLPTLAMSAGTLG SLQLPGVLTRLRVDLMSYLRHVQWLRRAGGPSLKTLEPELGALQARLERLLRRLQLLMSRLALPQ AAPDQPVIPLGPPASAWGSIRAAHAILGGLHLTLDWAVRGLLLLKTRLVDDIEGRMDEPKSCDKT HTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAK TKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPP SREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQ QGNVFSCSVMHEALHNHYTQKSLSLSPGK
Background Interleukin-11(IL-11) is a secreted protein and belongs to the IL-6 superfamily. IL-11 has been demonstrated to improve platelet recovery after chemotherapy-induced thrombocytopenia, induceacute phase proteins, modulate antigen-antibody responses, participate in the regulation of bone cellproliferation and differentiation and could be use as a therapeutic for osteoporosis. IL-11 stimulates the growth of certain lymphocytes and, in the murine model, stimulates an increase in the cortical thickness and strength of long bones. In addition to having lymphopoietic/hematopoietic and osteotrophic properties, it has functions in many other tissues, including the brain, gut, testis and bone.

Copyright @ USA Immuno Clone Co., Ltd(I&C) All Rights Reserved Language:Chinese