Recombinant Mouse Sialic Acid Binding Ig-Like Lectin 3/Siglec-3/CD33

Instruction Manual!

Product name:	Recombinant Mouse Sialic Acid Binding Ig-Like Lectin 3/Siglec-3/CD33
Source:	Human Cells
Purity:	Greater than 95% as determined by reducing SDS-PAGE.
Buffer Formulation:	Lyophilized from a 0.2 μm filtered solution of 20mM PB,150mM NaCl,pH7.4.
Applications:	Applications:SDS-PAGE; WB; ELISA; IP.
Storage:	Avoid repeated freeze/thaw cycles. Store at 2-8 oC for one month. Aliquot and store at -80 oC for 12 months.
UOM:	100ug/50ug/200ug/1mg/1g

Source	Human Cells
Description	Recombinant Mouse Sialic Acid Binding Ig-like Lectin 3 is produced by our Mammalian expression system and the target gene encoding Asp18-Glu240 is expressed with a 6His tag at the C-terminus.
Names	CD33/Myeloid cell surface antigen CD33/Sialic acid-binding Ig-like lectin 3/Siglec-3/Siglec3
Accession #	Q63994
Formulation	Lyophilized from a 0.2 μm filtered solution of 20mM PB,150mM NaCl,pH7.4.
Shipping	The product is shipped at ambient temperature.
Reconstitution	Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 μg/ml. Dissolve the lyophilized protein in ddH2O. Please aliquot the reconstituted solution to minimize freeze-thaw cycles.
Storage	Lyophilized protein should be stored at < -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at < -20°C for 3 months.
Purity	Greater than 95% as determined by reducing SDS-PAGE.
Endotoxin	Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
Amino Acid Sequence	DLEFQLVAPESVTVEEGLCVHVPCSVFYPSIKLTLGPVTGSWLRKGVSLHEDSPVATSDPRQLVQ KATQGRFQLLGDPQKHDCSLFIRDAQKNDTGMYFFRVVREPFVRYSYKKSQLSLHVTSLSRTPDI IIPGTLEAGYPSNLTCSVPWACEQGTPPTFSWMSTALTSLSSRTTDSSVLTFTPQPQDHGTKLTC LVTFSGAGVTVERTIQLNVTRKSGQMREVDHHHHHH
Background	Mouse myeloid cell surface antigen CD33(CD33) is a member of the immunoglobulin superfamily and SIGLEC (sialic acid binding Ig-like lectin) family. CD33 contains one Ig-like C2-type domain and one Ig-like V-type domain. CD33 is a putative adhesion molecule of myelomonocytic-derived cells that mediates sialic-acid dependent binding to cells. CD33 preferentially binds to alpha-2,6-linked sialic acid. The sialic acid recognition site may be masked by cis interactions with sialic acids on the same cell surface. In the immune response, CD33 may act as an inhibitory receptor upon ligand induced tyrosine phosphorylation by recruiting cytoplasmic phosphatase(s) via their SH2 domain(s) that block signal transduction through dephosphorylation of signaling molecules. CD33 induces apoptosis in acute myeloid leukemia. CD33 is becoming increasingly important as a target of antibody-mediated therapy in acute myeloid leukaemia (AML).