Recombinant Mouse Coagulation Factor X/F10

Instruction Manual!

Product name:	Recombinant Mouse Coagulation Factor X/F10
Source:	Human Cells
Purity:	Greater than 95% as determined by reducing SDS-PAGE.
Buffer Formulation:	Lyophilized from a 0.2 μm filtered solution of 20mM MES, 150mM NaCl and 1mM CaCl2 pH7.5..
Applications:	Applications:SDS-PAGE; WB; ELISA; IP.
Storage:	Avoid repeated freeze/thaw cycles. Store at 2-8 oC for one month. Aliquot and store at -80 oC for 12 months.
UOM:	100ug/50ug/200ug/1mg/1g

Source	Human Cells
Description	Recombinant Mouse Coagulation factor X is produced by our Mammalian expression system and the target gene encoding Gly21-Asn481 is expressed with a 6His tag at the C-terminus.
Names	F10/Coagulation factor X/Stuart factor
Accession #	O88947
Formulation	Lyophilized from a 0.2 μm filtered solution of 20mM MES, 150mM NaCl and 1mM CaCl2 pH7.5..
Shipping	The product is shipped at ambient temperature.
Reconstitution	Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 μg/ml. Dissolve the lyophilized protein in ddH2O. Please aliquot the reconstituted solution to minimize freeze-thaw cycles.
Storage	Lyophilized protein should be stored at < -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at < -20°C for 3 months.
Purity	Greater than 95% as determined by reducing SDS-PAGE.
Endotoxin	Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
Amino Acid Sequence	GKGVFINRERANNVLARTRRANSFFEEFKKGNLERECMEEICSYEEVREIFEDDEKTKEYWTKYK DGDQCESSPCQNQGACRDGIGGYTCTCSEGFEGKNCELFVRKLCRLDNGDCDQFCREEQNSVVCS CASGYFLGNDGKSCISTAPFPCGKITTGRRKRSVALNTSDSELDLEDALLDEDFLSPTENPIELL NLNETQPERSSDDLVRIVGGRECKDGECPWQALLINEDNEGFCGGTILNEFYILTAAHCLHQARR FKVRVGDRNTEKEEGNEMVHEVDVVIKHNKFQRDTYDYDIAVLRLKTPITFRMNVAPACLPQKDW AESTLMTQKTGIVSGFGRTHEKGRQSNILKMLEVPYVDRNTCKLSTSFSITQNMFCAGYEAKLED ACQGDSGGPHVTRFKNTYYVTGIVSWGEGCARKGKYGIYTKVTTFLKWIDRSMKARVGPTAETPR TAGPPNVDHHHHHH
Background	Mouse coagulation factor X / F10 a member of the peptidase S1 family. The mature F10 is composed mostly of two EGF-like domains, one Gla gamma-carboxy-glutamate domain and one peptidase S1 domain. Factor Xa is a vitamin K-dependent plasma protease that converts prothrombin to thrombin in the presence of factor Va, calcium and phospholipid during blood clotting. The two chains of F10 are formed from a single-chain precursor by the excision of two Arg residues. A single-chain precursor is initially synthesized in the liver. The light and heavy chains are linked together by disulfide bonds. The light chain contains a Gla and two EGF-like domains. The heavy chain corresponds to the serine protease domain. It can form a heterodimer with SERPINA5.