Recombinant Mouse Nectin-2/PVRL2/CD112

Instruction Manual!

Product name:	Recombinant Mouse Nectin-2/PVRL2/CD112
Source:	Human Cells
Purity:	Greater than 95% as determined by reducing SDS-PAGE.
Buffer Formulation:	Lyophilized from a 0.2 μm filtered solution of 20mM PB,150mM NaCl,pH7.4.
Applications:	Applications:SDS-PAGE; WB; ELISA; IP.
Storage:	Avoid repeated freeze/thaw cycles. Store at 2-8 oC for one month. Aliquot and store at -80 oC for 12 months.
UOM:	100ug/50ug/200ug/1mg/1g

Source	Human Cells
Description	Recombinant Mouse Nectin-2 is produced by our Mammalian expression system and the target gene encoding Gln32-Gly351 is expressed with a 6His tag at the C-terminus.
Names	CD112/nectin2 /Herpes virus entry mediator B/Herpesvirus entry mediator B/HveB/Murine herpes virus entry protein B/mHveB/Poliovirus receptor homolog/Poliovirus receptor-related protein 2/Pvrl2/Pvr/Mph/Pvs
Accession #	P32507
Formulation	Lyophilized from a 0.2 μm filtered solution of 20mM PB,150mM NaCl,pH7.4.
Shipping	The product is shipped at ambient temperature.
Reconstitution	Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 μg/ml. Dissolve the lyophilized protein in ddH2O. Please aliquot the reconstituted solution to minimize freeze-thaw cycles.
Storage	Lyophilized protein should be stored at < -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at < -20°C for 3 months.
Purity	Greater than 95% as determined by reducing SDS-PAGE.
Endotoxin	Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
Amino Acid Sequence	QDVRVRVLPEVRGRLGGTVELPCHLLPPTTERVSQVTWQRLDGTVVAAFHPSFGVDFPNSQFSKD RLSFVRARPETNADLRDATLAFRGLRVEDEGNYTCEFATFPNGTRRGVTWLRVIAQPENHAEAQE VTIGPQSVAVARCVSTGGRPPARITWISSLGGEAKDTQEPGIQAGTVTIISRYSLVPVGRADGVK VTCRVEHESFEEPILLPVTLSVRYPPEVSISGYDDNWYLGRSEAILTCDVRSNPEPTDYDWSTTS GVFPASAVAQGSQLLVHSVDRMVNTTFICTATNAVGTGRAEQVILVRESPSTAGAGATGGVDHHH HHH
Background	Nectin-2( CD112) is a member of the nectin family, which contains two Ig-like C2-type domains and one Ig-like V-type domain in the extracellular region. Nectins are type I transmembrane glycoproteins that are calcium-independent immunoglobulin (Ig)-like cell adhesion molecules (CAMs). Nectin2 is widely expressed in human tissues including brain, spinal cord, spleen, kidney, heart and liver. It can form trans-heterodimers with PVRL3/nectin-3 and interacts with CD226. Mutations of alleles of the murine CD112 gene can result in conditions such as morphologically aberrant spermatozoa. It may function in allergic reactions, and accordingly may used as a novel target for anti-allergic therapy.