Recombinant Mouse C-X-C Motif Chemokine 16/CXCL16/SR-PSOX

Instruction Manual!

Product name:	Recombinant Mouse C-X-C Motif Chemokine 16/CXCL16/SR-PSOX
Source:	Human Cells
Purity:	Greater than 95% as determined by reducing SDS-PAGE.
Buffer Formulation:	Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4 .
Applications:	Applications:SDS-PAGE; WB; ELISA; IP.
Storage:	Avoid repeated freeze/thaw cycles. Store at 2-8 oC for one month. Aliquot and store at -80 oC for 12 months.
UOM:	100ug/50ug/200ug/1mg/1g

Source	Human Cells
Description	Recombinant Mouse C-X-C motif chemokine 16 is produced by our Mammalian expression system and the target gene encoding Asn27-Trp201 is expressed with a 6His tag at the C-terminus.
Names	C-X-C motif chemokine 16,Scavenger receptor for phosphatidylserine,oxidized low density lipoprotein, Small-inducible cytokine B16, Transmembrane chemokine CXCL16, SR-PSOX, Zmynd15
Accession #	Q8BSU2
Formulation	Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4 .
Shipping	The product is shipped at ambient temperature.
Reconstitution	Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 μg/ml. Dissolve the lyophilized protein in ddH2O. Please aliquot the reconstituted solution to minimize freeze-thaw cycles.
Storage	Lyophilized protein should be stored at < -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at < -20°C for 3 months.
Purity	Greater than 95% as determined by reducing SDS-PAGE.
Endotoxin	Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
Amino Acid Sequence	NQGSVAGSCSCDRTISSGTQIPQGTLDHIRKYLKAFHRCPFFIRFQLQSKSVCGGSQDQWVRELV DCFERKECGTGHGKSFHHQKHLPQASTQTPEAAEGTPSDTSTPAHSQSTQHSTLPSGALSLNKEH TQPWEMTTLPSGYGLEARPEAEANEKQQDDRQQEAPGAGASTPAWVDHHHHHH
Background	CXCL16 is a single-pass type I membrane protein, which consists of 246 amino acids, CXCL16 induces a strong chemotatic response and calcium mobilization. CXCL16 acts as a scavenger receptor on macrophages, which specially binds to oxidized low density lipoprotein. CXCL16 may involves in pathophysiology such as atherogenesis. Soluble CXCL16 may play an important role in liver metastases through the induction of epithelial-mesenchymal transition.