Recombinant Mouse Carboxypeptidase M/CPM

Instruction Manual!

Product name:	Recombinant Mouse Carboxypeptidase M/CPM
Source:	Human Cells
Purity:	Greater than 95% as determined by reducing SDS-PAGE.
Buffer Formulation:	Lyophilized from a 0.2 μm filtered solution of PBS,pH7.4.
Applications:	Applications:SDS-PAGE; WB; ELISA; IP.
Storage:	Avoid repeated freeze/thaw cycles. Store at 2-8 oC for one month. Aliquot and store at -80 oC for 12 months.
UOM:	100ug/50ug/200ug/1mg/1g

Source	Human Cells
Description	Recombinant Mouse carboxypeptidase M is produced by our Mammalian expression system and the target gene encoding Leu18-Ser423 is expressed with a 6His tag at the C-terminus.
Names	Carboxypeptidase M,CPM
Accession #	Q80V42
Formulation	Lyophilized from a 0.2 μm filtered solution of PBS,pH7.4.
Shipping	The product is shipped at ambient temperature.
Reconstitution	Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 μg/ml. Dissolve the lyophilized protein in ddH2O. Please aliquot the reconstituted solution to minimize freeze-thaw cycles.
Storage	Lyophilized protein should be stored at < -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at < -20°C for 3 months.
Purity	Greater than 95% as determined by reducing SDS-PAGE.
Endotoxin	Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
Amino Acid Sequence	LDFRYHHQEGMEAFLKSVAQNYSSITHLHSIGKSVRGRNLWVLVVGQTPKEHRVGIPEFKYVANM HGDETVGRELLLHLIDYLVSSYRKDPEITHLIDSTRIHIMPSMNPDGFEAVQKPDCYYSNGRENY NNYDLNRNFPDAFENNNVTKQPETLAIMEWLKTETFVLSANLHGGALVASYPFDNGVQATGTLLS RSLTPDDDVFQHLAYTYASRNPNMTKGDQCKNKRNFPNGIINGYSWYPLQGGMQDYNYIWAQCFE ITLELSCCKYPREEKLPLFWNDNKASLIEYIKQVHLGVKGQVFDQSGAPLPNVIVEVQDRKHICP FRTNKLGEYYLLLLPGSYVINVTVPGHDSYLTKLTIPGKSQPFSALKKDFHLPLRWQPDSISVSN PSCPMIPLYKFMPSHSVDHHHHHH
Background	Carboxypeptidase M (CPM) belongs to the peptidase M14 family, and exists in cell membrane. The protein binds 1 zinc ion per subunit, and cleavage of C-terminal arginine or lysine residues from polypeptides. CPM specifically removes C-terminal basic residues (Arg or Lys) from peptides and proteins. It is believed to play important roles in the control of peptide hormone and growth factor activity at the cell surface, and in the membrane-localized degradation of extracellular proteins.