Recombinant Mouse CD5 Antigen-Like/CD5L/SPα/AIM

Instruction Manual!

Product name:	Recombinant Mouse CD5 Antigen-Like/CD5L/SPα/AIM
Source:	Human Cells
Purity:	Greater than 95% as determined by reducing SDS-PAGE.
Buffer Formulation:	Lyophilized from a 0.2 μm filtered solution of PBS,pH7.4.
Applications:	Applications:SDS-PAGE; WB; ELISA; IP.
Storage:	Avoid repeated freeze/thaw cycles. Store at 2-8 oC for one month. Aliquot and store at -80 oC for 12 months.
UOM:	100ug/50ug/200ug/1mg/1g

Source	Human Cells
Description	Recombinant Mouse CD5 Antigen-Like is produced by our Mammalian expression system and the target gene encoding Glu22-VaL352 is expressed with a 6His tag at the C-terminus.
Names	CD5 antigen-like,Apoptosis inhibitor expressed by macrophages,Apoptosis inhibitory 6,CT-2,SP-alpha,Cd5l,Aim, Api6
Accession #	Q9QWK4
Formulation	Lyophilized from a 0.2 μm filtered solution of PBS,pH7.4.
Shipping	The product is shipped at ambient temperature.
Reconstitution	Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 μg/ml. Dissolve the lyophilized protein in ddH2O. Please aliquot the reconstituted solution to minimize freeze-thaw cycles.
Storage	Lyophilized protein should be stored at < -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at < -20°C for 3 months.
Purity	Greater than 95% as determined by reducing SDS-PAGE.
Endotoxin	Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
Amino Acid Sequence	ESPTKVQLVGGAHRCEGRVEVEHNGQWGTVCDDGWDRRDVAVVCRELNCGAVIQTPRGASYQPPA SEQRVLIQGVDCNGTEDTLAQCELNYDVFDCSHEEDAGAQCENPDSDLLFIPEDVRLVDGPGHCQ GRVEVLHQSQWSTVCKAGWNLQVSKVVCRQLGCGRALLTYGSCNKNTQGKGPIWMGKMSCSGQEA NLRSCLLSRLENNCTHGEDTWMECEDPFELKLVGGDTPCSGRLEVLHKGSWGSVCDDNWGEKEDQ VVCKQLGCGKSLHPSPKTRKIYGPGAGRIWLDDVNCSGKEQSLEFCRHRLWGYHDCTHKEDVEVI CTDFDVVDHHHHHH
Background	CD5L, also known as CT-2,SP-alpha and CD5 antigen-like. It is expressed by the gene Cd5l. The protein is expressed in thymus, liver, spleen and lymph nodes. CD5L contains 3 SRCR domains, which are 102, 101, and 103aa.long. CD5L is glycosylated during post-translational modification. It may play a role in the regulation of the immune system, and seems to play a role as an inhibitor of apoptosis.