elisa kit elisa kits logo

Tel:631-424-0089
Fax:631-424-0095
Email: info@immunoclone.com

Home>>Products >>  Proteins

Recombinant Mouse C-X-C Motif Chemokine 1/CXCL1/GRO α

Recombinant Mouse C-X-C Motif Chemokine 1/CXCL1/GRO α Recombinant Mouse C-X-C Motif Chemokine 1/CXCL1/GRO α

Instruction Manual!

Product name: Recombinant Mouse C-X-C Motif Chemokine 1/CXCL1/GRO α
Source:Human Cells
Purity:Greater than 95% as determined by reducing SDS-PAGE.
Buffer Formulation:Lyophilized from a 0.2 μm filtered solution of PBS,pH7.4.
Applications:Applications:SDS-PAGE; WB; ELISA; IP.
Storage:Avoid repeated freeze/thaw cycles. Store at 2-8 oC for one month. Aliquot and store at -80 oC for 12 months.
UOM:100ug/50ug/200ug/1mg/1g
Source Human Cells
Description Recombinant Mouse C-X-C motif chemokine 1 is produced by our Mammalian expression system and the target gene encoding Arg20-Lys96 is expressed with a 6His tag at the C-terminus.
Names Growth-regulated alpha protein,C-X-C motif chemokine 1,Platelet-derived growth factor-inducible protein KC,Secretory protein N51,Cxcl1,Gro, Gro1, Mgsa, Scyb1
Accession # P12850
Formulation Lyophilized from a 0.2 μm filtered solution of PBS,pH7.4.
Shipping The product is shipped at ambient temperature.
Reconstitution Always centrifuge tubes before opening. Do not mix by vortex or pipetting.
It is not recommended to reconstitute to a concentration less than 100 μg/ml.
Dissolve the lyophilized protein in ddH2O.
Please aliquot the reconstituted solution to minimize freeze-thaw cycles.
Storage Lyophilized protein should be stored at < -20°C, though stable at room temperature for 3 weeks.
Reconstituted protein solution can be stored at 4-7°C for 2-7 days.
Aliquots of reconstituted samples are stable at < -20°C for 3 months.
Purity Greater than 95% as determined by reducing SDS-PAGE.
Endotoxin Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
Amino Acid Sequence
RLATGAPIANELRCQCLQTMAGIHLKNIQSLKVLPSGPHCTQTEVIATLKNGREACLDPEAPLVQ KIVQKMLKGVPKVDHHHHHH
Background Cxcl1, also called Gro, Gro1, Mgsa or Scyb1, is short for growth-regulated alpha protein. The protein belongs to the intercrine alpha (chemokine CxC) family. The N-terminal processed form KC(5-72) of the protein is produced by proteolytic cleavage after secretion from bone marrow stromal cells, and shows a highly enhanced hematopoietic activity. Cxcl1 has chemotactic activity for neutrophils, and contributes to neutrophil activation during inflammation. Hematoregulatory chemokine, in vitro, suppresses hematopoietic progenitor cell proliferation.

Copyright @ USA Immuno Clone Co., Ltd(I&C) All Rights Reserved Language:Chinese