Recombinant Mouse Probable Carboxypeptidase PM20D1/PM20d1
Product name: | Recombinant Mouse Probable Carboxypeptidase PM20D1/PM20d1 |
Source: | Human Cells |
Purity: | Greater than 95% as determined by reducing SDS-PAGE. |
Buffer Formulation: | Supplied as a 0.2 μm filtered solution of PBS,pH7.4. |
Applications: | Applications:SDS-PAGE; WB; ELISA; IP. |
Storage: | Avoid repeated freeze/thaw cycles. Store at 2-8 oC for one month. Aliquot and store at -80 oC for 12 months. |
UOM: | 100ug/50ug/200ug/1mg/1g |
Source | Human Cells |
Description | Recombinant Mouse PMKase is produced by our Mammalian expression system and the target gene encoding Ser25-Leu503 is expressed with a 6His tag at the C-terminus. |
Names | Probable carboxypeptidase PM20D1,Peptidase M20 domain-containing protein 1,Pm20d1 |
Accession # | Q8C165 |
Formulation | Supplied as a 0.2 μm filtered solution of PBS,pH7.4. |
Shipping |
The product is shipped on dry ice/ice packs. |
Storage |
Store at < -20°C, stable for 6 months after receipt. Please minimize freeze-thaw cycles. |
Purity |
Greater than 95% as determined by reducing SDS-PAGE. |
Endotoxin | Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test. |
Amino Acid Sequence |
STGPRSRENRGASRIPSQFSEEERVAIKEALKGAIQIPTVSFSHEESNTTALAEFGEYIRKAFPT VFHSSLVQHEVVAKYSHLFTIQGSDPSLQPYMLMAHIDVVPAPEEGWEVPPFSGLERNGFIYGRG ALDNKNSVMAILHALELLLIRNYSPKRSFFIALGHDEEVSGEKGAQKISALLQARGVQLAFLVDE GSFILEGFIPNLEKPVAMISVTEKGALDLMLQVNMTPGHSSAPPKETSIGILSAAVSRLEQTPMP NMFGGGPLKKTMKLLANEFSFPINIVLRNLWLFHPIVSRIMERNPITNALVRTTTALTMFNAGIK VNVIPPLAQATINCRIHPSQTVHEVLELVKNTVADDRVQLHVLRSFEPLPISPSDDQAMGYQLLQ ETIRSVFPEVDIVVPGICIANTDTRHYANITNGMYRFNPLPLNPQDFSGVHGINEKVSVQNYQNQ VKFIFEFIQNADTYKEPVPHLHELVDHHHHHH
|
Background | Probable carboxypeptidase PM20D1(PM20d1) is a secreted protein and belongs to the peptidase M20A family. |