Recombinant Mouse Tumor Necrosis Factor Receptor II/TNFRSF1B/CD120b

Instruction Manual!

Product name:	Recombinant Mouse Tumor Necrosis Factor Receptor II/TNFRSF1B/CD120b
Source:	Human Cells
Purity:	Greater than 95% as determined by reducing SDS-PAGE.
Buffer Formulation:	Lyophilized from a 0.2 μm filtered solution of PBS,pH7.4.
Applications:	Applications:SDS-PAGE; WB; ELISA; IP.
Storage:	Avoid repeated freeze/thaw cycles. Store at 2-8 oC for one month. Aliquot and store at -80 oC for 12 months.
UOM:	100ug/50ug/200ug/1mg/1g

Source	Human Cells
Description	Recombinant Mouse Tumor Necrosis Factor Receptor II is produced by our Mammalian expression system and the target gene encoding Val23-Gly258 is expressed with a 6His tag at the C-terminus.
Names	Tumor necrosis factor receptor superfamily member 1b,Tnfrsf1b,
Accession #	Q545P4
Formulation	Lyophilized from a 0.2 μm filtered solution of PBS,pH7.4.
Shipping	The product is shipped at ambient temperature.
Reconstitution	Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 μg/ml. Dissolve the lyophilized protein in ddH2O. Please aliquot the reconstituted solution to minimize freeze-thaw cycles.
Storage	Lyophilized protein should be stored at < -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at < -20°C for 3 months.
Purity	Greater than 95% as determined by reducing SDS-PAGE.
Endotoxin	Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
Amino Acid Sequence	VPAQVVLTPYKPEPGYECQISQEYYDRKAQMCCAKCPPGQYVKHFCNKTSDTVCADCEASMYTQV WNQFRTCLSCSSSCTTDQVEIRACTKQQNRVCACEAGRYCALKTHSGSCRQCMRLSKCGPGFGVA SSRAPNGNVLCKACAPGTFSDTTSSTDVCRPHRICSILAIPGNASTDAVCAPESPTLSAIPRTLY VSQPEPTRSQPLDQEPGPSQTPSILTSLGSTPIIEQSTKGGVDHHHHHH
Background	Tumor Necrosis Factor Receptor Superfamily Member 1B (TNFRSF1B) is a member of the Tumor Necrosis Factor Receptor Superfamily. TNFRSF1B contains four TNFR-Cys repeats. TNFRSF1B can be cleaved into the following 2 chains: Tumor necrosis factor receptor superfamily member 1b and membrane form and Tumor necrosis factor-binding protein 2. TNFRSF1B is a receptor with high affinity for TNFSF2/TNF-α and approximately 5-fold lower affinity for homotrimeric TNFSF1/lymphotoxin-α. TNFRSF1B mediates most of the metabolic effects of TNF-α. TNF-α-induced apoptosis suggests that it regulates TNF-α function by antagonizing its biological activity.