Recombinant Mouse C-C Motif Chemokine 24/CCL24/Eotaxin-2

Instruction Manual!

Product name:	Recombinant Mouse C-C Motif Chemokine 24/CCL24/Eotaxin-2
Source:	E.coli
Purity:	Greater than 95% as determined by reducing SDS-PAGE.
Buffer Formulation:	Lyophilized from a 0.2 μm filtered solution of PBS,pH7.4.
Applications:	Applications:SDS-PAGE; WB; ELISA; IP.
Storage:	Avoid repeated freeze/thaw cycles. Store at 2-8 oC for one month. Aliquot and store at -80 oC for 12 months.
UOM:	100ug/50ug/200ug/1mg/1g

Source	E.coli
Description	Recombinant Mouse C-C Motif Chemokine 24 is produced by our E.coli expression system and the target gene encoding Val27-Val119 is expressed.
Names	C-C motif chemokine 24,Ccl24,Eosinophil chemotactic protein 2,Eotaxin-2,Small-inducible cytokine A24,Scya24
Accession #	Q9JKC0
Formulation	Lyophilized from a 0.2 μm filtered solution of PBS,pH7.4.
Shipping	The product is shipped at ambient temperature.
Reconstitution	Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 μg/ml. Dissolve the lyophilized protein in ddH2O. Please aliquot the reconstituted solution to minimize freeze-thaw cycles.
Storage	Lyophilized protein should be stored at < -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at < -20°C for 3 months.
Purity	Greater than 95% as determined by reducing SDS-PAGE.
Endotoxin	Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
Amino Acid Sequence	VTIPSSCCTSFISKKIPENRVVSYQLANGSICPKAGVIFITKKGHKICTDPKLLWVQRHIQKLDA KKNQPSKGAKAVRTKFAVQRRRGNSTEV
Background	Mouse CCL24 is a secreted protein, which is a member of the CC chemokine subfamily. Mouse Ccl24 cDNA encodes a 119 amino acid residue precursor protein, shares approximately 58% amino acid sequence identity with human Ccl24. It is predominantly expressed in the jejunum and spleen and also be induced in the lung by allergen challengeand IL4. Mouse ccl24 has lower chemotactic activity for neutrophils but none for monocytes and activated lymphocytes. Ccl24 is chemotactic for resting T-lymphocytes, eosinophils and can bind to CCR3. LPS and IL4 also differentially regulate the expression of Ccl24 in monocytes and macrophages.