Recombinant Rat Interleukin-2/IL-2

Instruction Manual!

Product name:	Recombinant Rat Interleukin-2/IL-2
Source:	Human Cells
Purity:	Greater than 95% as determined by reducing SDS-PAGE.
Buffer Formulation:	Supplied as a 0.2 μm filtered solution of 5mM NaH2PO4, 5mM Citric acid, 150mM NaCl, pH4.0.
Applications:	Applications:SDS-PAGE; WB; ELISA; IP.
Storage:	Avoid repeated freeze/thaw cycles. Store at 2-8 oC for one month. Aliquot and store at -80 oC for 12 months.
UOM:	100ug/50ug/200ug/1mg/1g

Source	Human Cells
Description	Recombinant Rat Interleukin-2 is produced by our Mammalian expression system and the target gene encoding Ala21-Gln155 is expressed with a 6His tag at the C-terminus.
Names	Interleukin-2; IL-2; T-cell growth factor; TCGF; Aldesleukin; IL2
Accession #	P17108
Formulation	Supplied as a 0.2 μm filtered solution of 5mM NaH2PO4, 5mM Citric acid, 150mM NaCl, pH4.0.
Shipping	The product is shipped on dry ice/ice packs.
Storage	Store at < -20°C, stable for 6 months after receipt. Please minimize freeze-thaw cycles.
Purity	Greater than 95% as determined by reducing SDS-PAGE.
Endotoxin	Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
Amino Acid Sequence	APTSSPAKETQQHLEQLLLDLQVLLRGIDNYKNLKLPMMLTFKFYLPKQATELKHLQCLENELGA LQRVLDLTQSKSFHLEDAGNFISNIRVTVVKLKGSENKFECQFDDEPATVVEFLRRWIAICQSII STMTQHHHHHH
Background	Interleukin-2(IL-2)is a O-glycosylated four α-helix bundle cytokine that has potent stimulatory activity for antigenactivated T cells. It is expressed by CD4+ and CD8+ T cells, γδ T cells, B cells, dendritic cells, and eosinophils. Mature rat IL-2 shares 66% and 73% amino acid sequence identity with human and mouse IL-2,respectively. The receptor for IL-2 consists of three subunits that are present on the cell surface in varying preformed complexes. IL-2 is a powerful immunoregulatory lymphokine produced by T-cells in response to antigenic or mitogenic stimulation. IL-2/IL-2R signaling is required for T-cell proliferation and other fundamental functions that are essential for the immune response. IL-2 stimulates growth and differentiation of B-cells, NK cells, lymphokine-activated killer cells, monocytes, macrophages and oligodendrocytes.