Recombinant Rat T-lymphocyte Activation Antigen CD80/B7-1

Instruction Manual!

Product name:	Recombinant Rat T-lymphocyte Activation Antigen CD80/B7-1
Source:	Human Cells
Purity:	Greater than 95% as determined by reducing SDS-PAGE.
Buffer Formulation:	Lyophilized from a 0.2 μm filtered solution of PBS, pH7.4.
Applications:	Applications:SDS-PAGE; WB; ELISA; IP.
Storage:	Avoid repeated freeze/thaw cycles. Store at 2-8 oC for one month. Aliquot and store at -80 oC for 12 months.
UOM:	100ug/50ug/200ug/1mg/1g

Source	Human cells
Description	Recombinant Rat T-lymphocyte Activation Antigen CD81 is produced by our Mammalian expression system and the target gene encoding Vla30-Gln248 is expressed with a 6His tag at the C-terminus.
Names	T-lymphocyte activation antigen CD80; Activation B7-1 antigen; B7; CD80
Accession #	O35187
Formulation	Lyophilized from a 0.2 μm filtered solution of PBS, pH7.4.
Shipping	The product is shipped at ambient temperature.
Reconstitution	Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 μg/ml. Dissolve the lyophilized protein in ddH2O. Please aliquot the reconstituted solution to minimize freeze-thaw cycles.
Storage	Lyophilized protein should be stored at < -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at < -20°C for 3 months.
Purity	Greater than 95% as determined by reducing SDS-PAGE.
Endotoxin	Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
Amino Acid Sequence	VGLFQISSGIVGQVSKSVREKALLSCDYKFCSEEQSIHRIYWQKHDKMVLSVISGVPEVWPEYKN RTVYDIANNYSFSLLGLILSDRGTYTCVVQRYEGESYVVKHLTTVELSVRADFPTPNITESGNPS ADIKRITCFASGGFPKPRLSWLENGRELNGINTTISQDPESELYTISSQLDFNTTYDHFIDCFIE YGDAHVSQNFTWVKPPEDPPDEKQHHHHHH
Background	Cluster of Differentiation 80, also called B7-1, is a member of cell surface immunoglobulin superfamily which plays key, yet distinct roles in the activation of T cells. B7-1/CD80 and B7-2/CD86, together with their receptors CD28 and CTLA4, constitute one of the dominant co-stimulatory pathways that regulate T- and B- cell responses. CD80 is mostly expressed on the surface of antigen-presenting cells including activated B cells, macrophages and dendritic cells. Although both CTLA-4 and CD28 can bind to the same ligands, CTLA-4 binds to B7-1 and B7-2 with a 20-100 fold higher affinity than CD28 and is involved in the down-regulation of the immune response.