Recombinant Rat IgG2A Fc/Igg-2a

Instruction Manual!

Product name:	Recombinant Rat IgG2A Fc/Igg-2a
Source:	Human Cells
Purity:	Greater than 95% as determined by reducing SDS-PAGE.
Buffer Formulation:	Lyophilized from a 0.2 μm filtered solution of 20mM Tris, pH 8.5.
Applications:	Applications:SDS-PAGE; WB; ELISA; IP.
Storage:	Avoid repeated freeze/thaw cycles. Store at 2-8 oC for one month. Aliquot and store at -80 oC for 12 months.
UOM:	100ug/50ug/200ug/1mg/1g

Source	Human Cells
Description	Recombinant Rat Immunoglobulin G2A Fc is produced by our Mammalian expression system and the target gene encoding Val98-Lys322 is expressed.
Names	Ig gamma-2A chain C region， Igg-2a
Accession #	P20760
Formulation	Lyophilized from a 0.2 μm filtered solution of 20mM Tris, pH 8.5.
Shipping	The product is shipped at ambient temperature.
Reconstitution	Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 μg/ml. Dissolve the lyophilized protein in ddH2O. Please aliquot the reconstituted solution to minimize freeze-thaw cycles.
Storage	Lyophilized protein should be stored at < -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at < -20°C for 3 months.
Purity	Greater than 95% as determined by reducing SDS-PAGE.
Endotoxin	Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
Amino Acid Sequence	VPRECNPCGCTGSEVSSVFIFPPKTKDVLTITLTPKVTCVVVDISQNDPEVRFSWFIDDVEVHTA QTHAPEKQSNSTLRSVSELPIVHRDWLNGKTFKCKVNSGAFPAPIEKSISKPEGTPRGPQVYTMA PPKEEMTQSQVSITCMVKGFYPPDIYTEWKMNGQPQENYKNTPPTMDTDGSYFLYSKLNVKKETW QQGNTFTCSVLHEGLHNHHTEKSLSHSPGK
Background	Immunoglobulin G (IgG) is a type of antibody composed of four peptide chains—two identical heavy chains and two identical light chains arranged in a Y-shape typical of antibody monomers.There are four IgG subclasses (IgG1, 2, 3, and 4) in humans, named in order of their abundance in serum. The IgG2a isotype was able to interact very efficiently with FcgammaR, and share approximately 64-78% amino acid sequence identity with IgG1 and IgG2b in the heavy chain constant region domains, CH1, CH2 and CH3, which cause the diffrence in the interaction with complement, NK and mast cells, induction or inhibition by specific cytokines, and ability to cross the placenta.