Recombinant Mouse Granzyme B (G,H)/GZMB
| Product name: | Recombinant Mouse Granzyme B (G,H)/GZMB |
| Source: | Human Cells |
| Purity: | Greater than 95% as determined by reducing SDS-PAGE. |
| Buffer Formulation: | Supplied as a 0.2 μm filtered solution of PBS,pH7.4. |
| Applications: | Applications:SDS-PAGE; WB; ELISA; IP. |
| Storage: | Avoid repeated freeze/thaw cycles. Store at 2-8 oC for one month. Aliquot and store at -80 oC for 12 months. |
| UOM: | 100ug/50ug/200ug/1mg/1g |
| Source | Human Cells |
| Description | Recombinant Mouse Granzyme B is produced by our Mammalian expression system and the target gene encoding Gly19-Ser247 is expressed with a 6His tag at the C-terminus. |
| Names | Granzyme B(G,H),CTLA-1,Cytotoxic cell protease 1,CCP1,Fragmentin-2,Gzmb,Ctla-1, Ctla1 |
| Accession # | P04187 |
| Formulation | Supplied as a 0.2 μm filtered solution of PBS,pH7.4. |
| Shipping |
The product is shipped on dry ice/ice packs. |
| Storage |
Store at < -20°C, stable for 6 months after receipt. Please minimize freeze-thaw cycles. |
| Purity |
Greater than 95% as determined by reducing SDS-PAGE. |
| Endotoxin | Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test. |
| Amino Acid Sequence |
GEIIGGHEVKPHSRPYMALLSIKDQQPEAICGGFLIREDFVLTAAHCEGSIINVTLGAHNIKEQE KTQQVIPMVKCIPHPDYNPKTFSNDIMLLKLKSKAKRTRAVRPLNLPRRNVNVKPGDVCYVAGWG RMAPMGKYSNTLQEVELTVQKDRECESYFKNRYNKTNQICAGDPKTKRASFRGDSGGPLVCKKVA AGIVSYGYKDGSPPRAFTKVSSFLSWIKKTMKSSVDHHHHHH
|
| Background | Granzyme B(GZMB) contains 1 peptidase S1 domain and belongs to the peptidase S1 family. This enzyme is necessary for target cell lysis in cell-mediated immune responses. It cleaves after Asp and seems to be linked to an activation cascade of caspases (aspartate-specific cysteine proteases) responsible for apoptosis execution. The protein cleaves caspase-3, -7, -9 and 10 to give rise to active enzymes mediating apoptosis. |












