elisa kit elisa kits logo

Tel:631-424-0089
Fax:631-424-0095
Email: info@immunoclone.com

Home>>Products >>  Proteins

Recombinant Mouse SLAMF6/NTB-A/CD352

Recombinant Mouse SLAMF6/NTB-A/CD352 Recombinant Mouse SLAMF6/NTB-A/CD352

Instruction Manual!

Product name: Recombinant Mouse SLAMF6/NTB-A/CD352
Source:Human Cells
Purity:Greater than 95% as determined by reducing SDS-PAGE.
Buffer Formulation:Lyophilized from a 0.2 μm filtered solution of PBS, pH7.4.
Applications:Applications:SDS-PAGE; WB; ELISA; IP.
Storage:Avoid repeated freeze/thaw cycles. Store at 2-8 oC for one month. Aliquot and store at -80 oC for 12 months.
UOM:100ug/50ug/200ug/1mg/1g
Source Human Cells
Description Recombinant Mouse SLAMF6 is produced by our Mammalian expression system and the target gene encoding Glu31-Asn239 is expressed with a 6His tag at the N-terminus.
Names SLAM family member 6, Lymphocyte antigen 108,Ly108, SLAMF6, RP11-528G1.1, FLJ50657, KALI, KALIb, MGC104953, NTB-A, NTBA, SF2000 ,Ly108, Slamf6, KAL1, KAL1b, NTB-A, NTBA, SF2000
Accession # Q9ET39
Formulation Lyophilized from a 0.2 μm filtered solution of PBS, pH7.4.
Shipping The product is shipped at ambient temperature.
Reconstitution Always centrifuge tubes before opening. Do not mix by vortex or pipetting.
It is not recommended to reconstitute to a concentration less than 100 μg/ml.
Dissolve the lyophilized protein in ddH2O.
Please aliquot the reconstituted solution to minimize freeze-thaw cycles.
Storage Lyophilized protein should be stored at < -20°C, though stable at room temperature for 3 weeks.
Reconstituted protein solution can be stored at 4-7°C for 2-7 days.
Aliquots of reconstituted samples are stable at < -20°C for 3 months.
Purity Greater than 95% as determined by reducing SDS-PAGE.
Endotoxin Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
Amino Acid Sequence
HHHHHHEVSQSSSDPQLMNGVLGESAVLPLKLPAGKIANIIIWNYEWEASQVTALVINLSNPESP QIMNTDVKKRLNITQSYSLQISNLTMADTGSYTAQITTKDSEVITFKYILRVFERLGNLETTNYT LLLENGTCQIHLACVLKNQSQTVSVEWQATGNISLGGPNVTIFWDPRNSGDQTYVCRAKNAVSNL SVSVSTQSLCKGVLTNPPWN
Background SLAM family member 6(SLAMF6) is a single-pass type I membrane protein and contains 1 Ig-like (immunoglobulin-like) domain. It belongs to the CD2 subfamily of the immunoglobulin superfamily. This encoded protein is expressed on Natural killer (NK), T and B lymphocytes. It undergoes tyrosine phosphorylation and associates with the Src homology 2 domain-containing protein (SH2D1A) as well as with SH2 domain-containing phosphatases (SHPs). It may function as a coreceptor in the process of NK cell activation. It can also mediate inhibitory signals in NK cells from X-linked lymphoproliferative patients.

Copyright @ USA Immuno Clone Co., Ltd(I&C) All Rights Reserved Language:Chinese