Recombinant Mouse Transglutaminase 2/TGM2
Product name: | Recombinant Mouse Transglutaminase 2/TGM2 |
Source: | Human Cells |
Purity: | Greater than 95% as determined by reducing SDS-PAGE. |
Buffer Formulation: | Supplied as a 0.2 μm filtered solution of 20mM TrisHCl,150mM NaCl,20%Glycerol,pH7.5. |
Applications: | Applications:SDS-PAGE; WB; ELISA; IP. |
Storage: | Avoid repeated freeze/thaw cycles. Store at 2-8 oC for one month. Aliquot and store at -80 oC for 12 months. |
UOM: | 100ug/50ug/200ug/1mg/1g |
Source | Human Cells |
Description | Recombinant Mouse Transglutaminase 2 is produced by our Mammalian expression system and the target gene encoding Ala2-Ala686 is expressed with a 6His tag at the C-terminus. |
Names | Protein-glutamine gamma-glutamyltransferase 2,Tgm2,Tissue transglutaminase,Transglutaminase C,TGase-2 |
Accession # | P21981 |
Formulation | Supplied as a 0.2 μm filtered solution of 20mM TrisHCl,150mM NaCl,20%Glycerol,pH7.5. |
Shipping |
The product is shipped on dry ice/ice packs. |
Storage |
Store at < -20°C, stable for 6 months after receipt. Please minimize freeze-thaw cycles. |
Purity |
Greater than 95% as determined by reducing SDS-PAGE. |
Endotoxin | Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test. |
Amino Acid Sequence |
AEELLLERCDLEIQANGRDHHTADLCQEKLVLRRGQRFRLTLYFEGRGYEASVDSLTFGAVTGPD PSEEAGTKARFSLSDNVEEGSWSASVLDQQDNVLSLQLCTPANAPIGLYRLSLEASTGYQGSSFV LGHFILLYNAWCPADDVYLDSEEERREYVLTQQGFIYQGSVKFIKSVPWNFGQFEDGILDTCLML LDMNPKFLKNRSRDCSRRSSPIYVGRVVSAMVNCNDDQGVLLGRWDNNYGDGISPMAWIGSVDIL RRWKEHGCQQVKYGQCWVFAAVACTVLRCLGIPTRVVTNYNSAHDQNSNLLIEYFRNEFGELESN KSEMIWNFHCWVESWMTRPDLQPGYEGWQAIDPTPQEKSEGTYCCGPVSVRAIKEGDLSTKYDAP FVFAEVNADVVDWIRQEDGSVLKSINRSLVVGQKISTKSVGRDDREDITHTYKYPEGSPEEREVF TKANHLNKLAEKEETGVAMRIRVGDSMSMGNDFDVFAHIGNDTSETRECRLLLCARTVSYNGVLG PECGTEDINLTLDPYSENSIPLRILYEKYSGCLTESNLIKVRGLLIEPAANSYLLAERDLYLENP EIKIRVLGEPKQNRKLVAEVSLKNPLSDPLYDCIFTVEGAGLTKEQKSVEVSDPVPAGDLVKARV DLFPTDIGLHKLVVNFQCDKLKSVKGYRNVIIGPAVDHHHHHH
|
Background | Protein-glutamine gamma-glutamyltransferase 2 (TGM2) is a 78-kDa, calcium dependent enzyme,It belongs to the transglutaminase superfamily and transglutaminase family. The protein encoded by this TGM2 gene acts as a monomer, is induced by retinoic acid, and appears to be involved in apoptosis. TGM2 is the autoantigen implicated in celiac disease. Two transcript variants encoding different isoforms have been found for this gene. |