Recombinant Mouse C-X-C Motif Chemokine 9/CXCL9

Instruction Manual!

Product name:	Recombinant Mouse C-X-C Motif Chemokine 9/CXCL9
Source:	E.coli
Purity:	Greater than 95% as determined by reducing SDS-PAGE.
Buffer Formulation:	Lyophilized from a 0.2 μm filtered solution of 20mM Tris,200mM NaCl,pH8.3
Applications:	Applications:SDS-PAGE; WB; ELISA; IP.
Storage:	Avoid repeated freeze/thaw cycles. Store at 2-8 oC for one month. Aliquot and store at -80 oC for 12 months.
UOM:	100ug/50ug/200ug/1mg/1g

Source	E.coli
Description	Recombinant Mouse Fibroblast growth factor 9 is produced by our E.coli expression system and the target gene encoding Met1Ser208 is expressed with a 8his tag at the C-terminus.
Names	C-X-C motif chemokine 9;Cxcl9;Gamma-interferon-induced monokine;Monokine induced by interferon-gamma;MIG;Small-inducible cytokine B9;Scyb9
Accession #	P18340
Formulation	Lyophilized from a 0.2 μm filtered solution of 20mM Tris,200mM NaCl,pH8.3
Shipping	The product is shipped at ambient temperature.
Reconstitution	Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 μg/ml. Dissolve the lyophilized protein in ddH4O. Please aliquot the reconstituted solution to斯㉠쓐㍂ፀ㢄Å㉠㢄Å耀ؿ耀
Storage	Lyophilized protein should be stored at < -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at < -20°C for 3 months.
Purity	Greater than 95% as determined by reducing SDS-PAGE.
Endotoxin	Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
Amino Acid Sequence	MTLVIRNARCSCISTSRGTVHYKSLKDLKQFAPSPNCNKTEIIATLKNGDQTCLDPDSANVKKLM KEWEKKINQKKKQKRGKKHQKNMKNRKPKTPQSRRRSRKTT
Background	Chemokine (C-X-C motif) ligand 9 (CXCL9, MIG), is a small cytokine belonging to the CXC chemokine family. CXCL9 functions as one of the three ligands of chemokine receptor CXCR3 which is a G protein-coupled receptor found predominantly on T cells. It together with CXCL10 and CXCL11, may activate CXCR3 by binding to it. CXCL9 serves as a cytokine that affects the growth, movement, or activation state of cells that participate in immune and inflammatory response. It has been observed that tumour endothelial cells secrete high levels of CXCL9 in all, and CXCL10 in most melanoma metastases. it plays an important role in CD4+ T lymphocyte recruitment and development of CAV, MOMA-2+ macrophages are the predominant recipient-derived source of CXCL9, and recipient CD4 lymphocytes are necessary for sustained CXCL9 production and CAV development in this model.