Recombinant Mouse Peptidyl-prolyl Cis-trans Isomerase A/Cyclophilin A/CYPA

Instruction Manual!

Product name:	Recombinant Mouse Peptidyl-prolyl Cis-trans Isomerase A/Cyclophilin A/CYPA
Source:	E.coli
Purity:	Greater than 95% as determined by reducing SDS-PAGE.
Buffer Formulation:	Supplied as a 0.2 μm filtered solution of PBS, 10%glycerol, pH7.4.
Applications:	Applications:SDS-PAGE; WB; ELISA; IP.
Storage:	Avoid repeated freeze/thaw cycles. Store at 2-8 oC for one month. Aliquot and store at -80 oC for 12 months.
UOM:	100ug/50ug/200ug/1mg/1g

Source	E.coli
Description	Recombinant Mouse Peptidyl-prolyl Cis-trans Isomerase A is produced by our E.coli expression system and the target gene encoding Met1-Leu164 is expressed.
Names	Peptidyl-prolyl cis-trans isomerase A; PPIase A; Cyclophilin A; Cyclosporin A-binding protein; Rotamase A; SP18; PPIA; CYPA
Accession #	P17742
Formulation	Supplied as a 0.2 μm filtered solution of PBS, 10%glycerol, pH7.4.
Shipping	The product is shipped on dry ice/ice packs.
Storage	Store at < -20°C, stable for 6 months after receipt. Please minimize freeze-thaw cycles.
Purity	Greater than 95% as determined by reducing SDS-PAGE.
Endotoxin	Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
Amino Acid Sequence	MVNPTVFFDITADDEPLGRVSFELFADKVPKTAENFRALSTGEKGFGYKGSSFHRIIPGFMCQGG DFTRHNGTGGRSIYGEKFEDENFILKHTGPGILSMANAGPNTNGSQFFICTAKTEWLDGKHVVFG KVKEGMNIVEAMERFGSRNGKTSKKITISDCGQL
Background	Peptidyl-prolyl cis-trans isomerase A is a cytoplasm protein which belongs to the cyclophilin-type PPIase family and PPIase A subfamily. Cyclophilins(CyPs) are a family of proteins found in organisms ranging from prokaryotes to humans. These molecules exhibit peptidyl-prolyl isomerase activity, suggesting that they influence the conformation of proteins in cells. Cyclophilin A accelerate the folding of proteins. It catalyzes the cis-trans isomerization of proline imidic peptide bonds in oligopeptides. Cyclophilin A can interact with several HIV proteins, including p55 gag, Vpr, and capsid protein, and has been shown to be necessary for the formation of infectious HIV virions.