Recombinant Mouse Fibroblast Growth Factor 17/FGF-17

Instruction Manual!

Product name:	Recombinant Mouse Fibroblast Growth Factor 17/FGF-17
Source:	E.coli
Purity:	Greater than 95% as determined by reducing SDS-PAGE.
Buffer Formulation:	Lyophilized from a 0.2 μm filtered solution of 20mM PB, 150mM NaCl,EDTA,DTT, pH 7.4.
Applications:	Applications:SDS-PAGE; WB; ELISA; IP.
Storage:	Avoid repeated freeze/thaw cycles. Store at 2-8 oC for one month. Aliquot and store at -80 oC for 12 months.
UOM:	100ug/50ug/200ug/1mg/1g

Source	E.coli
Description	Recombinant Mouse Fibroblast Growth Factor 17 is produced by our expression system and the target gene encoding Thr23-Thr216 is expressed with a 6His tag at the C-terminus.
Names	Fibroblast growth factor 17, FGF-17,fgf17
Accession #	P63075
Formulation	Lyophilized from a 0.2 μm filtered solution of 20mM PB, 150mM NaCl,EDTA,DTT, pH 7.4.
Shipping	The product is shipped at ambient temperature.
Reconstitution	Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 μg/ml. Dissolve the lyophilized protein in ddH2O. Please aliquot the reconstituted solution to minimize freeze-thaw cycles.
Storage	Lyophilized protein should be stored at < -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at < -20°C for 3 months.
Purity	Greater than 95% as determined by reducing SDS-PAGE.
Endotoxin	Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
Amino Acid Sequence	MTQGENHPSPNFNQYVRDQGAMTDQLSRRQIREYQLYSRTSGKHVQVTGRRISATAEDGNKFAKL IVETDTFGSRVRIKGAESEKYICMNKRGKLIGKPSGKSKDCVFTEIVLENNYTAFQNARHEGWFM AFTRQGRPRQASRSRQNQREAHFIKRLYQGQLPFPNHAERQKQFEFVGSAPTRRTKRTRRPQSQT LEHHHHHH
Background	FGF-17 is a member of the fibroblast growth factor (FGF) family. FGFs share 30 70% amino acid (aa) identity in a conserved, approximately 120 amino acid core domain. FGFs play multiple roles in biological functions, including angiogenesis, mitogenesis, cell differentiation and wound repair. FGF17 plays an important role in the regulation of embryonic development and as signaling molecule in the induction and patterning of the embryonic brain. It is also expressed in hindgut, parts of the developing skeleton, tail bud, major arteries, and heart. In many of these areas, it is expressed along with FGF-8, but slightly later. It is required for normal brain development.