Recombinant Mouse Interleukin-18/IL-18/IL-1F4

Instruction Manual!

Product name:	Recombinant Mouse Interleukin-18/IL-18/IL-1F4
Source:	E.coli
Purity:	Greater than 95% as determined by reducing SDS-PAGE.
Buffer Formulation:	Lyophilized from a 0.2 μm filtered solution of PBS,pH7.4.
Applications:	Applications:SDS-PAGE; WB; ELISA; IP.
Storage:	Store at -20℃. Avoid freeze / thaw cycles.
UOM:	100ug/50ug/200ug/1mg/1g

Source	E.coli
Description	Recombinant Mouse Interleukin-18 is produced by our E.coli expression system and the target gene encoding Asn36-Ser192 is expressed with a 6His tag at the N-terminus.
Names	Interleukin-18,Il18,Interferon gamma-inducing factor,IFN-gamma-inducing factor,Interleukin-1 gamma,IL-1 gamma,Igif, REF: C1006
Accession #	P70380
Formulation	Lyophilized from a 0.2 μm filtered solution of PBS,pH7.4.
Shipping	The product is shipped at ambient temperature.
Reconstitution	Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 μg/ml. Dissolve the lyophilized protein in ddH2O. Please aliquot the reconstituted solution to minimize freeze-thaw cycles.
Storage	Lyophilized protein should be stored at < -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at < -20°C for 3 months.
Purity	Greater than 95% as determined by reducing SDS-PAGE.
Endotoxin	Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
Amino Acid Sequence	MNHKVHHHHHHMNFGRLHCTTAVIRNINDQVLFVDKRQPVFEDMTDIDQSASEPQTRLIIYMYKD SEVRGLAVTLSVKDSKMSTLSCKNKIISFEEMDPPENIDDIQSDLIFFQKRVPGHNKMEFESSLY EGHFLACQKEDDAFKLILKKKDENGDKSVMFTLTNLHQS
Background	Interleukin-18 (IL18, also known as interferon-gamma inducing factor) is a protein which in mouse is encoded by the IL18 gene, belongs to the IL-1 family. Augments natural killer cell activity in spleen cells and stimulates interferon gamma production in T-helper type I cells