Recombinant Mouse Interleukin-2/IL‐2

Instruction Manual!

Product name:	Recombinant Mouse Interleukin-2/IL‐2
Source:	E.coli
Purity:	Greater than 95% as determined by reducing SDS-PAGE.
Buffer Formulation:	Lyophilized from a 0.2 μm filtered solution of 20mM Sodium Citrate, 5% Trehalose, pH4.5.
Applications:	Applications:SDS-PAGE; WB; ELISA; IP.
Storage:	Avoid repeated freeze/thaw cycles. Store at 2-8 oC for one month. Aliquot and store at -80 oC for 12 months.
UOM:	100ug/50ug/200ug/1mg/1g

Source	E.coli
Description	Recombinant Mouse Interleukin-2 is produced by our E.coli expression system and the target gene encoding Ala21-Gln169 is expressed.
Names	aldesleukin, interleukin 2, interleukin-2, IL-2, IL2, T-cell growth facter, T cell growth factor, TCGF , REF: C1025
Accession #	P04351
Formulation	Lyophilized from a 0.2 μm filtered solution of 20mM Sodium Citrate, 5% Trehalose, pH4.5.
Shipping	The product is shipped at ambient temperature.
Reconstitution	Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 μg/ml. Dissolve the lyophilized protein in ddH2O. Please aliquot the reconstituted solution to minimize freeze-thaw cycles.
Storage	Lyophilized protein should be stored at < -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at < -20°C for 3 months.
Biological Activity	The ED50 for this effect is typically 0.10.4 ng/mL.
Purity	Greater than 95% as determined by reducing SDS-PAGE.
Endotoxin	Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
Amino Acid Sequence	MAPTSSSTSSSTAEAQQQQQQQQQQQQHLEQLLMDLQELLSRMENYRNLKLPRMLTFKFYLPKQA TELKDLQCLEDELGPLRHVLDLTQSKSFQLEDAENFISNIRVTVVKLKGSDNTFECQFDDESATV VDFLRRWIAFCQSIISTSPQ
Background	Interleukin 2 (IL 2), also termed T-cell growth factor, is a member of the cytokine family which includes IL-4, IL-7, IL-9, IL-15 and IL-21. Each member of this family has a four alpha helix bundle. IL-2 signals through the IL-2 receptor, a complex consisting of tree subunits, termed alpha, beta and gamma. The IL-2 R gamma is shared by cytokine receptors of all members of cytokine family. Mature mouse IL2 shares 56% and 73% aa sequence identity with human and rat IL2, respectively. IL-2 is produced by CD4+ T cell, CD8+ T cells, gamma δ T cells, B cells, dendritic cells and eosinophils, and plays a vital role in key function of the immune system, tolerance and immunity, primarily via its potent stimulatory activity for T cells.Thus, IL2 may be a key cytokine in the natural suppression of autoimmunity.