| ELISA kit |
| Clinical diagnosis |
| Trfia |
| ANTIBODIES |
| CLIA kits |
| Proteins |
| New Products |
| > Human |
| > Canine |
| > Bovine |
| > Equine |
| > Fish |
| > Mouse |
| > Rat |
| > Chicken |
| > Porcine |
| > Rabbit |
| > Goat |
| > Simian |
| > General |
| > Cavia |
| > Caprine |
| > Sheep |
| > Cattle |
Recombinant Mouse GM-CSF/CSF2
Instruction Manual!
| Product name: | Recombinant Mouse GM-CSF/CSF2 |
| Source: | E.coli |
| Purity: | Greater than 95% as determined by reducing SDS-PAGE. |
| Buffer Formulation: | Lyophilized from a 0.2 μm filtered solution of 20mM PB,150mM NaCl, pH7.4. |
| Applications: | Applications:SDS-PAGE; WB; ELISA; IP. |
| Storage: | Avoid repeated freeze/thaw cycles. Store at 2-8 oC for one month. Aliquot and store at -80 oC for 12 months. |
| UOM: | 100ug/50ug/200ug/1mg/1g |
| Source | E.coli |
| Description | Recombinant Mouse Granulocyte-Macrophage Colony-Stimulating Factor is produced by our E.coli expression system and the target gene encoding Ala18-Lys141 is expressed. |
| Names | Granulocyte-macrophage colony-stimulating factor,Csf2,GM-CSF,Colony-stimulating factor,Csfgm, REF: C1002 |
| Accession # | P01587 |
| Formulation | Lyophilized from a 0.2 μm filtered solution of 20mM PB,150mM NaCl, pH7.4. |
| Shipping |
The product is shipped at ambient temperature. |
| Reconstitution |
Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 μg/ml. Dissolve the lyophilized protein in ddH2O. Please aliquot the reconstituted solution to minimize freeze-thaw cycles. |
| Storage |
Lyophilized protein should be stored at < -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at < -20°C for 3 months. |
| Purity |
Greater than 95% as determined by reducing SDS-PAGE. |
| Endotoxin | Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test. |
| Amino Acid Sequence |
MAPTRSPITVTRPWKHVEAIKEALNLLDDMPVTLNEEVEVVSNEFSFKKLTCVQTRLKIFEQGLR GNFTKLKGALNMTASYYQTYCPPTPETDCETQVTTYADFIDSLKTFLTDIPFECKKPGQK
|
| Background | Granulocyte-macrophage colony-stimulating factor is an enzyme that in mouse is encoded by the Csf2 gene, belongs to the GM-CSF family.CSF2 is a Cytokine that stimulates the growth and differentiation of hematopoietic precursor cells from various lineages, including granulocytes, macrophages, eosinophils and erythrocytes |
