Recombinant Human δ(3,5)-δ(2,4)-Dienoyl-CoA Isomerase, Mitochondrial/ECH1

Instruction Manual!

Product name:	Recombinant Human δ(3,5)-δ(2,4)-Dienoyl-CoA Isomerase, Mitochondrial/ECH1
Source:	E.coli
Purity:	Greater than 95% as determined by reducing SDS-PAGE.
Buffer Formulation:	Supplied as a 0.2 μm filtered solution of 20mM Tris,100mM NaCl,10% Glycerol,pH 8.0.
Applications:	Applications:SDS-PAGE; WB; ELISA; IP.
Storage:	Avoid repeated freeze/thaw cycles. Store at 2-8 oC for one month. Aliquot and store at -80 oC for 12 months.
UOM:	100ug/50ug/200ug/1mg/1g

Source	E.coli
Description	Recombinant Human ECH1 is produced by our E.coli expression system and the target gene encoding Thr34-Leu328 is expressed with a 6His tag at the N-terminus.
Names	Delta(3,5)-Delta(2,4)-dienoyl-CoA isomerase, mitochondrial,ECH1,, REF: C1008
Accession #	Q13011
Formulation	Supplied as a 0.2 μm filtered solution of 20mM Tris,100mM NaCl,10% Glycerol,pH 8.0.
Shipping	The product is shipped on dry ice/ice packs.
Storage	Store at < -20°C, stable for 6 months after receipt. Please minimize freeze-thaw cycles.
Purity	Greater than 95% as determined by reducing SDS-PAGE.
Endotoxin	Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
Amino Acid Sequence	MGSSHHHHHHSSGLVPRGSHMTGSSAQEEASGVALGEAPDHSYESLRVTSAQKHVLHVQLNRPNK RNAMNKVFWREMVECFNKISRDADCRAVVISGAGKMFTAGIDLMDMASDILQPKGDDVARISWYL RDIITRYQETFNVIERCPKPVIAAVHGGCIGGGVDLVTACDIRYCAQDAFFQVKEVDVGLAADVG TLQRLPKVIGNQSLVNELAFTARKMMADEALGSGLVSRVFPDKEVMLDAALALAAEISSKSPVAV QSTKVNLLYSRDHSVAESLNYVASWNMSMLQTQDLVKSVQATTENKELKTVTFSKL
Background	Human delta(3,5)-Delta(2,4)-dienoyl-CoA isomerase(ECH1) is a member of the hydratase/isomerase superfamily and contains a C-terminal peroxisomal targeting sequence and localizes to peroxisomes. ECH1 shows high sequence similarity to enoyl-CoA hydratases of several species, particularly within a conserved domain characteristic of these proteins. The rat orthologlocalizes to the matrix of both the peroxisome and mitochondria.It can isomerize 3-trans, 5-cis-dienoyl-CoA to 2-trans,4-trans-dienoyl-CoA, indicating that it is a delta3,5-delta2,4-dienoyl-CoA isomerase. ECH1 plays an important role in the auxiliary step of the fatty acid beta-oxidation pathway.