Recombinant Human Glutathione S-transferase P/GSTP1

Instruction Manual!

Product name:	Recombinant Human Glutathione S-transferase P/GSTP1
Source:	E.coli
Purity:	Greater than 95% as determined by reducing SDS-PAGE.
Buffer Formulation:	Supplied as a 0.2 μm filtered solution of 20mM Tris,150mM NaCl,10% Glycerol,pH 8.0.
Applications:	Applications:SDS-PAGE; WB; ELISA; IP.
Storage:	Avoid repeated freeze/thaw cycles. Store at 2-8 oC for one month. Aliquot and store at -80 oC for 12 months.
UOM:	100ug/50ug/200ug/1mg/1g

Source	E.coli
Description	Recombinant Human Glutathione S-Transferase pi 1 is produced by our E.coli expression system and the target gene encoding Met1-Glu210 is expressed.
Names	Glutathione S-transferase P;GSTP1;GST class-pi;GSTP1-1;FAEES3;GST3;
Accession #	P09211
Formulation	Supplied as a 0.2 μm filtered solution of 20mM Tris,150mM NaCl,10% Glycerol,pH 8.0.
Shipping	The product is shipped on dry ice/ice packs.
Storage	Store at < -20°C, stable for 6 months after receipt. Please minimize freeze-thaw cycles.
Purity	Greater than 95% as determined by reducing SDS-PAGE.
Endotoxin	Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
Amino Acid Sequence	MMPPYTVVYFPVRGRCAALRMLLADQGQSWKEEVVTVETWQEGSLKASCLYGQLPKFQDGDLTLY QSNTILRHLGRTLGLYGKDQQEAALVDMVNDGVEDLRCKYVSLIYTNYEAGKDDYVKALPGQLKP FETLLSQNQGGKTFIVGDQISFADYNLLDLLLIHEVLAPGCLDAFPLLSAYVGRLSARPKLKAFL ASPEYVNLPINGNGKQ
Background	Glutathione S-transferase P (GSTP1) is an enzyme that contains 1 GST C-terminal domain, 1 GST N-terminal domain. GSTP1 belongs to the GST superfamily, the GSTs are a family of enzymes that play an important role in detoxification by catalyzing the conjugation of many hydrophobic and electrophilic compounds with reduced glutathione. Based on their biochemical, immunologic, and structural properties, the soluble GSTs are categorized into 4 main classes: alpha, mu, pi, and theta. The glutathione S-transferase pi gene (GSTP1) is a polymorphic gene encoding active, functionally different GSTP1 variant proteins. Besides, it regulates negatively CDK5 activity via p25/p35 translocation to prevent neurodegeneration. It thought to function in xenobiotic metabolism and play a role in susceptibility to cancer, and other diseases.