Recombinant Human Fibroblast Growth Factor 8/FGF-8a

Instruction Manual!

Product name:	Recombinant Human Fibroblast Growth Factor 8/FGF-8a
Source:	E.coli
Purity:	Greater than 95% as determined by reducing SDS-PAGE.
Buffer Formulation:	Lyophilized from a 0.2 μm filtered solution of 20mM PB, 150mM NaCl, 1mM EDTA, 1mM DTT,pH 7.4.
Applications:	Applications:SDS-PAGE; WB; ELISA; IP.
Storage:	Avoid repeated freeze/thaw cycles. Store at 2-8 oC for one month. Aliquot and store at -80 oC for 12 months.
UOM:	100ug/50ug/200ug/1mg/1g

Source	E.coli
Description	Recombinant Human Fibroblast growth factor 8a is produced by our E.coli expression system and the target gene encoding Gln23-Arg204 is expressed with a 6His tag at the N-terminus.
Names	Fibroblast growth factor 8,Androgen-induced growth factor,Heparin-binding growth factor 8,AIGF,HBGF-8,FGF-8B, REF: C1013
Accession #	P55075-2
Formulation	Lyophilized from a 0.2 μm filtered solution of 20mM PB, 150mM NaCl, 1mM EDTA, 1mM DTT,pH 7.4.
Shipping	The product is shipped at ambient temperature.
Reconstitution	Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 μg/ml. Dissolve the lyophilized protein in ddH2O. Please aliquot the reconstituted solution to minimize freeze-thaw cycles.
Storage	Lyophilized protein should be stored at < -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at < -20°C for 3 months.
Purity	Greater than 95% as determined by reducing SDS-PAGE.
Endotoxin	Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
Amino Acid Sequence	MGSSHHHHHHSSGLVPRGSHMQHVREQSLVTDQLSRRLIRTYQLYSRTSGKHVQVLANKRINAMA EDGDPFAKLIVETDTFGSRVRVRGAETGLYICMNKKGKLIAKSNGKGKDCVFTEIVLENNYTALQ NAKYEGWYMAFTRKGRPRKGSKTRQHQREVHFMKRLPRGHHTTEQSLRFEFLNYPPFTRSLRGSQ RTWAPEPR
Background	Fibroblast growth factor 8 (FGF8) is a member of the fibroblast growth factor family. It is discovered as a growth factor essential for the androgen-dependent growth of mouse mammary carcinoma cells. Mouse FGF8b shares 100% aa identity with human FGF8b. FGF8 is widely expressed during embryogenesis, and mediates epithelial-mesenchymal transitions. It plays an important role in the regulation of embryonic development, cell proliferation, cell differentiation and cell migration. It is required for normal brain, eye, ear, limb development during embryogenesis and normal development of the gonadotropin-releasing hormone (GnRH) neuronal system.