Recombinant Cavia porcellus Interleukin-1 Beta/IL-1 beta

Instruction Manual!

Product name:	Recombinant Cavia porcellus Interleukin-1 Beta/IL-1 beta
Source:	E.coli
Purity:	Greater than 95% as determined by reducing SDS-PAGE.
Buffer Formulation:	Lyophilized from a 0.2 μm filtered solution of PBS, pH7.4.
Applications:	Applications:SDS-PAGE; WB; ELISA; IP.
Storage:	Avoid repeated freeze/thaw cycles. Store at 2-8 oC for one month. Aliquot and store at -80 oC for 12 months.
UOM:	100ug/50ug/200ug/1mg/1g

Source	E.coli
Description	Recombinant Cavia porcellus Interleukin-1 Beta is produced by our E.coli expression system and the target gene encoding Thr115-Ser266 is expressed with a 6His tag at the C-terminus.
Names	Interleukin-1 beta; IL-1 beta; IL1B
Accession #	Q9WVG1
Formulation	Lyophilized from a 0.2 μm filtered solution of PBS, pH7.4.
Shipping	The product is shipped at ambient temperature.
Reconstitution	Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 μg/ml. Dissolve the lyophilized protein in ddH2O. Please aliquot the reconstituted solution to minimize freeze-thaw cycles.
Storage	Lyophilized protein should be stored at < -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at < -20°C for 3 months.
Purity	Greater than 95% as determined by reducing SDS-PAGE.
Endotoxin	Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
Amino Acid Sequence	MTPVPSRNCTLHDIQHKRLVLSDPCELKALHLNGDNLNRQVVFSMSFVQGERSDNKMPVALGLKG KNLYLSCVMKDGKPVLQLESVDGKQYPKKKMEKRFVFNKITSKSTVEFESAQFPNWYISTSQAEH KPVFLGNNNGQDIIDFKLELVSSHHHHHH
Background	Interleukin-1 beta (IL1B) belongs to the IL-1 family. Interleukin 1 (IL-1) is a family of polypeptide cytokines consisting of two agonists, IL-1 alpha (IL-1F1) and IL-1 beta (IL-1F2) encoded by two distinct genes and perform identical biological functions. IL-1 stimulates thymocyte proliferation by inducing IL-2 release, B-cell maturation and proliferation, and fibroblast growth factor activity. IL-1 proteins are involved in the inflammatory response. It is identified as endogenous pyrogens, and is reported to stimulate the release of prostaglandin and collagenase from synovial cells.