Recombinant Human Microtubule-associated Proteins 1A/1B Light Chain 3B/MAP1LC3B

Instruction Manual!

Product name:	Recombinant Human Microtubule-associated Proteins 1A/1B Light Chain 3B/MAP1LC3B
Source:	E.coli
Purity:	Greater than 95% as determined by reducing SDS-PAGE.
Buffer Formulation:	Lyophilized from a 0.2 μm filtered solution of 20mM Tris, 150mM NaCl, 2mM DTT, pH8.0.
Applications:	Applications:SDS-PAGE; WB; ELISA; IP.
Storage:	Avoid repeated freeze/thaw cycles. Store at 2-8 oC for one month. Aliquot and store at -80 oC for 12 months.
UOM:	100ug/50ug/200ug/1mg/1g

Source	E.coli
Description	Recombinant Human Microtubule-associated Proteins 1A/1B Light Chain 3B is produced by our E.coli expression system and the target gene encoding Met1-Val125 is expressed.
Names	Microtubule-associated proteins 1A/1B light chain 3B; Autophagy-related protein LC3 B; Autophagy-related ubiquitin-like modifier LC3 B; MAP1 light chain 3-like protein 2; MAP1A/MAP1B light chain 3 B; MAP1A/MAP1B LC3 B; Microtubule-associated protein 1 light chain 3 beta; MAP1LC3B; MAP1ALC3
Accession #	Q9GZQ8
Formulation	Lyophilized from a 0.2 μm filtered solution of 20mM Tris, 150mM NaCl, 2mM DTT, pH8.0.
Shipping	The product is shipped at ambient temperature.
Reconstitution	Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 μg/ml. Dissolve the lyophilized protein in ddH2O. Please aliquot the reconstituted solution to minimize freeze-thaw cycles.
Storage	Lyophilized protein should be stored at < -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at < -20°C for 3 months.
Purity	Greater than 95% as determined by reducing SDS-PAGE.
Endotoxin	Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
Amino Acid Sequence	GSMPSEKTFKQRRTFEQRVEDVRLIREQHPTKIPVIIERYKGEKQLPVLDKTKFLVPDHVNMSEL IKIIRRRLQLNANQAFFLLVNGHSMVSVSTPISEVYESEKDEDGFLYMVYASQETFGMKLSV
Background	Microtubule-associated proteins 1A/1B light chain 3B (MAP1LC3B) is a member of the highly conserved ATG8 protein family. ATG8 proteins are present in all known eukaryotic organisms. MAP1LC3B is one of the four genes in the MAP1LC3 subfamily (others include MAP1LC3A, MAP1LC3C, and MAP1LC3B2). It is moat abundantly expressed in heart, brain, skeletal muscle and testis. LMAP1LC3B is a subunit of neuronal microtubule and functions in formation of autophagosomal vacuoles (autophagosomes). It associated MAP1A and MAP1B proteins, which are involved in microtubule assembly and important for neurogenesis. MAP1LC3B also plays a role in autophagy, a process that involves the bulk degradation of cytoplasmic component.