Recombinant Mouse C-X-C Motif Chemokine 2/CXCL2/MIP-2
| Product name: | Recombinant Mouse C-X-C Motif Chemokine 2/CXCL2/MIP-2 |
| Source: | E.coli |
| Purity: | Greater than 95% as determined by reducing SDS-PAGE. |
| Buffer Formulation: | Lyophilized from a 0.2 μm filtered solution of 20mM Tris,150mM NaCl,pH8.0. |
| Applications: | Applications:SDS-PAGE; WB; ELISA; IP. |
| Storage: | Avoid repeated freeze/thaw cycles. Store at 2-8 oC for one month. Aliquot and store at -80 oC for 12 months. |
| UOM: | 100ug/50ug/200ug/1mg/1g |
| Source | E.coli |
| Description | Recombinant Mouse C-X-C motif chemokine 2 is produced by our E.coli expression system and the target gene encoding Ala28-Asn100 is expressed. |
| Names | MIP-2; chemokine ligand 2; C-X-C motif chemokine 2; GRO beta; GRO2; GROB; Gro-beta; Growth-regulated protein beta; Macrophage Inflammatory Protein-2-alpha; melanoma growth stimulatory activity beta; cxcl2; MGSA-b; MGSA-beta; MIP2A; MIP2-alpha; SCYB2. |
| Accession # | P10889 |
| Formulation | Lyophilized from a 0.2 μm filtered solution of 20mM Tris,150mM NaCl,pH8.0. |
| Shipping |
The product is shipped at ambient temperature. |
| Reconstitution |
Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 μg/ml. Dissolve the lyophilized protein in ddH2O. Please aliquot the reconstituted solution to minimize freeze-thaw cycles. |
| Storage |
Lyophilized protein should be stored at < -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at < -20°C for 3 months. |
| Purity |
Greater than 95% as determined by reducing SDS-PAGE. |
| Endotoxin | Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test. |
| Amino Acid Sequence |
AVVASELRCQCLKTLPRVDFKNIQSLSVTPPGPHCAQTEVIATLKGGQKVCLDPEAPLVQKIIQK ILNKGKAN
|
| Background | C-X-C motif chemokine 2 (CXCL2,MIP-2) belongs to the intercrine alpha (chemokine CxC) family. It was originally identified as a heparin-binding protein secreted from a murine macrophage cell line in response to endotoxin stimulation. The expression of mouse MIP-2 is stimulated by endotoxin. The mouse MIP-2 shares approximately 63% aa sequence identity with murine KC, another mouse alpha chemokine, which is induced by PDGF. It has been suggested that mouse KC and MIP-2 are the homologs of the human GROs and rat CINCs. Chemotactic for human polymorphonuclear leukocytes but does not induce chemokinesis or an oxidative burst. The expression of MIP-2 was found to be associated with neutrophil influx in pulmonary inflammation and glomerulonephritis, suggesting that MIP-2 may contribute to the pathogenesis of inflammatory diseases. |












