Recombinant Human Mothers Against Decapentaplegic Homolog 2/SMAD2

Instruction Manual!

Product name:	Recombinant Human Mothers Against Decapentaplegic Homolog 2/SMAD2
Source:	E.coli
Purity:	Greater than 95% as determined by reducing SDS-PAGE.
Buffer Formulation:	Lyophilized from a 0.2 μm filtered solution of 20mM PB,500mM NaCl, pH7.5.
Applications:	Applications:SDS-PAGE; WB; ELISA; IP.
Storage:	Avoid repeated freeze/thaw cycles. Store at 2-8 oC for one month. Aliquot and store at -80 oC for 12 months.
UOM:	100ug/50ug/200ug/1mg/1g

Source	E.coli
Description	Recombinant Human Mothers Against Decapentaplegic Homolog 2 is produced by our E.coli expression system and the target gene encoding Ser2-Ser467 is expressed with a 6His, Flag tag at the N-terminus.
Names	Mothers against decapentaplegic homolog 2; MAD homolog 2; Mad-related protein 2; hMAD-2; SMAD family member 2; SMAD 2; Smad2; Hsmad2; SMAD2; MADH2; MADR2
Accession #	Q15796
Formulation	Lyophilized from a 0.2 μm filtered solution of 20mM PB,500mM NaCl, pH7.5.
Shipping	The product is shipped at ambient temperature.
Reconstitution	Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 μg/ml. Dissolve the lyophilized protein in ddH2O. Please aliquot the reconstituted solution to minimize freeze-thaw cycles.
Storage	Lyophilized protein should be stored at < -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at < -20°C for 3 months.
Purity	Greater than 95% as determined by reducing SDS-PAGE.
Endotoxin	Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
Amino Acid Sequence	MRGSHHHHHHGSDYKDDDDKSSILPFTPPVVKRLLGWKKSAGGSGGAGGGEQNGQEEKWCEKAVK SLVKKLKKTGRLDELEKAITTQNCNTKCVTIPSTCSEIWGLSTPNTIDQWDTTGLYSFSEQTRSL DGRLQVSHRKGLPHVIYCRLWRWPDLHSHHELKAIENCEYAFNLKKDEVCVNPYHYQRVETPVLP PVLVPRHTEILTELPPLDDYTHSIPENTNFPAGIEPQSNYIPETPPPGYISEDGETSDQQLNQSM DTGSPAELSPTTLSPVNHSLDLQPVTYSEPAFWCSIAYYELNQRVGETFHASQPSLTVDGFTDPS NSERFCLGLLSNVNRNATVEMTRRHIGRGVRLYYIGGEVFAECLSDSAIFVQSPNCNQRYGWHPA TVCKIPPGCNLKIFNNQEFAALLAQSVNQGFEAVYQLTRMCTIRMSFVKGWGAEYRRQTVTSTPC WIELHLNGPLQWLDKVLTQMGSPSVRCSSMS
Background	Mothers against decapentaplegic homolog 2(SMAD2) is a cytoplasm protein which belongs to the dwarfin/SMAD family. Smad proteins undergo rapid nuclear translocation upon stimulation by transforming growth factor and in so doing transduce the signal into the nucleus. Receptor-regulated SMAD is an intracellular signal transducer and transcriptional modulator activated by TGF-beta and activin type 1 receptor kinases. SMAD2 is contains 1 MH1 (MAD homology 1) domain and1 MH2 (MAD homology 2) domain. It is expressed at high levels in skeletal muscle, endothelial cells, heart and placenta. It binds the TRE element in the promoter region of many genes that are regulated by TGF-beta and, on formation of the SMAD2/SMAD4 complex, activates transcription. It may act as a tumor suppressor in colorectal carcinoma. And SMAD2 positively regulates PDPK1 kinase activity by stimulating its dissociation from the 14-3-3 protein YWHAQ which acts as a negative regulator.