Recombinant Human Induced Myeloid Leukemia Cell Differentiation Protein Mcl-1/MC

Instruction Manual!

Product name:	Recombinant Human Induced Myeloid Leukemia Cell Differentiation Protein Mcl-1/MC
Source:	E.coli
Purity:	Greater than 95% as determined by reducing SDS-PAGE.
Buffer Formulation:	Supplied as a 0.2 μm filtered solution of 20mM Tris, 200mM NaCl, 2mM DTT, 20% glycerol, pH8.0.
Applications:	Applications:SDS-PAGE; WB; ELISA; IP.
Storage:	Avoid repeated freeze/thaw cycles. Store at 2-8 oC for one month. Aliquot and store at -80 oC for 12 months.
UOM:	100ug/50ug/200ug/1mg/1g

Source	E.coli
Description	Recombinant Human Bcl-2-related protein Mcl-1 is produced by our E.coli expression system and the target gene encoding Met1-Gly327 is expressed with a 6His tag at the N-terminus.
Names	Induced myeloid leukemia cell differentiation protein Mcl-1; Bcl-2-like protein 3; Bcl2-L-3; Bcl-2-related protein EAT/mcl1; mcl1/EAT; MCL1; BCL2L3
Accession #	Q07820
Formulation	Supplied as a 0.2 μm filtered solution of 20mM Tris, 200mM NaCl, 2mM DTT, 20% glycerol, pH8.0.
Shipping	The product is shipped on dry ice/ice packs.
Storage	Store at < -20°C, stable for 6 months after receipt. Please minimize freeze-thaw cycles.
Purity	Greater than 95% as determined by reducing SDS-PAGE.
Endotoxin	Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
Amino Acid Sequence	MNHKVHHHHHHMFGLKRNAVIGLNLYCGGAGLGAGSGGATRPGGRLLATEKEASARREIGGGEAG AVIGGSAGASPPSTLTPDSRRVARPPPIGAEVPDVTATPARLLFFAPTRRAAPLEEMEAPAADAI MSPEEELDGYEPEPLGKRPAVLPLLELVGESGNNTSTDGSLPSTPPPAEEEEDELYRQSLEIISR YLREQATGAKDTKPMGRSGATSRKALETLRRVGDGVQRNHETAFQGMLRKLDIKNEDDVKSLSRV MIHVFSDGVTNWGRIVTLISFGAFVAKHLKTINQESCIEPLAESITDVLVRTKRDWLVKQRGWDG FVEFFHVEDLEGG
Background	Induced myeloid leukemia cell differentiation protein Mcl-1 (MCL1) is a member of the Bcl-2 family. MCL1 takes part in the control of apoptosis against cell existence, and in the preservation of viability but not of proliferation. MCL1 Involved in the regulation of apoptosis versus cell survival, and in the maintenance of viability but not of proliferation. It mediates its effects by interactions with a number of other regulators of apoptosis. Alternative splicing happens at this locus and two transcript variants encoding different isoforms are known. Isoform 1 is the longer gene product and it increases cell existence by inhibiting apoptosis. Isoform 2 is a shorter gene product which indorses apoptosis and is death-inducing.