Recombinant Human Bcl-2-like Protein 11/BIML

Instruction Manual!

Product name:	Recombinant Human Bcl-2-like Protein 11/BIML
Source:	E.coli
Purity:	Greater than 95% as determined by reducing SDS-PAGE.
Buffer Formulation:	Supplied as a 0.2 μm filtered solution of 20mM HEPES, 150mM NaCl, 10% glycerol, 2mM DTT, pH8.0
Applications:	Applications:SDS-PAGE; WB; ELISA; IP.
Storage:	Avoid repeated freeze/thaw cycles. Store at 2-8 oC for one month. Aliquot and store at -80 oC for 12 months.
UOM:	100ug/50ug/200ug/1mg/1g

Source	E.coli
Description	Recombinant Human Bcl-2-like Protein 11 is produced by our E.coli expression system and the target gene encoding Met1-Arg120 is expressed with a 6His tag at the N-terminus.
Names	Bcl-2-like protein 11; Bcl2-L-11; Bcl2-interacting mediator of cell death; BCL2L11; BIM; BIML
Accession #	O43521-2
Formulation	Supplied as a 0.2 μm filtered solution of 20mM HEPES, 150mM NaCl, 10% glycerol, 2mM DTT, pH8.0
Shipping	The product is shipped on dry ice/ice packs.
Storage	Store at < -20°C, stable for 6 months after receipt. Please minimize freeze-thaw cycles.
Purity	Greater than 95% as determined by reducing SDS-PAGE.
Endotoxin	Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
Amino Acid Sequence	MNHKVHHHHHHMAKQPSDVSSECDREGRQLQPAERPPQLRPGAPTSLQTEPQDRSPAPMSCDKST QTPSPPCQAFNHYLSAMASMRQAEPADMRPEIWIAQELRRIGDEFNAYYARRVFLNNYQAAEDHP R
Background	BIML is one of several splice variants of BIM, a proapoptotic protein belonging to the BH-3 domain-only subgroup of Bcl-2 family members. BCL-2 family members form hetero- or homodimers and act as anti- or pro-apoptotic regulators that are involved in a wide variety of cellular activities. BIML is thought to promote apoptosis by binding and inhibiting the activity of anti-apoptotic Bcl-2 family members, thereby inducing the release of cytochrome c from mitochondria. BIML is normally sequestered in an inactive conformation from anti-apoptotic Bcl-2 family members through binding to the microtubule-associated dynein motor complex. Certain apoptotic stimuli release BIML from microtubules to neutralize anti-apoptotic Bcl-2 family members, allowing for the initiation of apoptosis.