Recombinant Human Nucleobindin-2/Nesfatin-1

Instruction Manual!

Product name:	Recombinant Human Nucleobindin-2/Nesfatin-1
Source:	E.coli
Purity:	Greater than 95% as determined by reducing SDS-PAGE.
Buffer Formulation:	Lyophilized from a 0.2 μm filtered solution of 10mM Sodium Phosphate,pH6.5.
Applications:	Applications:SDS-PAGE; WB; ELISA; IP.
Storage:	Avoid repeated freeze/thaw cycles. Store at 2-8 oC for one month. Aliquot and store at -80 oC for 12 months.
UOM:	100ug/50ug/200ug/1mg/1g

Source	E.coli
Description	Recombinant Human Nucleobindin-2 is produced by our E.coli expression system and the target gene encoding Val25-Leu106 is expressed.
Names	Nucleobindin-2; DNA-binding protein NEFA; Gastric cancer antigen Zg4; Prepronesfatin; Nesfatin-1; NUCB2; NEFA
Accession #	P80303
Formulation	Lyophilized from a 0.2 μm filtered solution of 10mM Sodium Phosphate,pH6.5.
Shipping	The product is shipped at ambient temperature.
Reconstitution	Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 μg/ml. Dissolve the lyophilized protein in ddH2O. Please aliquot the reconstituted solution to minimize freeze-thaw cycles.
Storage	Lyophilized protein should be stored at < -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at < -20°C for 3 months.
Purity	Greater than 95% as determined by reducing SDS-PAGE.
Endotoxin	Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
Amino Acid Sequence	VPIDIDKTKVQNIHPVESAKIEPPDTGLYYDEYLKQVIDVLETDKHFREKLQKADIEEIKSGRLS KELDLVSHHVRTKLDEL
Background	Nesfatin-1 is a metabolic polypeptide encoded in the N-terminal region of the precursor protein, Nucleobindin2 (NUCB2). Nesfatin-1 is a neuropeptide produced in the hypothalamus of mammals. It participates in the regulation of hunger and fat storage. Nesfatin-1 is also expressed in other areas of the brain, and in pancreatic islets β-cells, gastric endocrine cells and adipocytes. Nesfatin-1 suppresses food intake and can regulate energy metabolism in a Leptin independent manner. Nesfatin-1 may also exert hypertensive roles and modulate blood pressure through directly acting on peripheral arterial resistance.